LFY, EF127065.1-LFY.m1 (mRNA) Crataegus dahurica

Transcript Overview
NameLFY
Unique NameEF127065.1-LFY.m1
TypemRNA
OrganismCrataegus dahurica ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
LFYEF127065.1-LFYCrataegus dahuricagene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
LFYLFYCrataegus dahuricagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
EF127065.1-LFY.m1-cds1EF127065.1-LFY.m1-cds1Crataegus dahuricaCDS
EF127065.1-LFY.m1-cds2EF127065.1-LFY.m1-cds2Crataegus dahuricaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
LFYEF127065.1-LFY.p1Crataegus dahuricapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI121485127
nuccoreEF127065.1
Alignments
Feature NameTypeLocationAnalysis
EF127065 region EF127065:1..442+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
ProductLEAFY protein
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>EF127065.1-LFY.m1 ID=EF127065.1-LFY.m1|Name=LFY|organism=Crataegus dahurica|type=mRNA|length=210bp
atggtgacggarccgggggaggtggcgcgtggcaaaaagaacggcctcga
ttacctcttccatctctacgagcaatgccgcgatttcttgatccaggtgc
agaacattgccaaggagcgcggtgaaaaatgtcccaccaaggtgacaaac
caagtgtttaggtatgccaaaaaggcaggggcaagctacatcaacaaacc
caaaatgagc
back to top

protein sequence of LFY

>EF127065.1-LFY.p1 ID=EF127065.1-LFY.p1|Name=LFY|organism=Crataegus dahurica|type=polypeptide|length=70bp
MVTEPGEVARGKKNGLDYLFHLYEQCRDFLIQVQNIAKERGEKCPTKVTN
QVFRYAKKAGASYINKPKMS
back to top

mRNA from alignment at EF127065:1..442+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>EF127065.1-LFY.m1 ID=EF127065.1-LFY.m1|Name=LFY|organism=Crataegus dahurica|type=mRNA|length=442bp|location=Sequence derived from alignment at EF127065:1..442+ (Crataegus dahurica)
atggtgacggarccgggggaggtggcgcgtggcaaaaagaacggcctcga ttacctcttccatctctacgagcaatgccgcgatttcttgatccaggtgc agaacattgccaaggagcgcggtgaaaaatgtcccaccaaggtacgaagt tttacccgtctcccctctttacgtacgctgatttctactgtggcaattaa ttaacagaaaaaattcttgtatgaagtccgtcaaatttaccatttcgtgt accacatacataacgatctggtacaaggtattaacggaagttgaggttta gggatgtcctcgagttggaacaaaatgtataatttccttttgcatttgtt tactctttacattatatacgcaggtgacaaaccaagtgtttaggtatgcc aaaaaggcaggggcaagctacatcaacaaacccaaaatgagc
back to top

Coding sequence (CDS) from alignment at EF127065:1..442+

>EF127065.1-LFY.m1 ID=EF127065.1-LFY.m1|Name=LFY|organism=Crataegus dahurica|type=CDS|length=210bp|location=Sequence derived from alignment at EF127065:1..442+ (Crataegus dahurica)
atggtgacggarccgggggaggtggcgcgtggcaaaaagaacggcctcga
ttacctcttccatctctacgagcaatgccgcgatttcttgatccaggtgc
agaacattgccaaggagcgcggtgaaaaatgtcccaccaaggtgacaaac
caagtgtttaggtatgccaaaaaggcaggggcaagctacatcaacaaacc
caaaatgagc
back to top