LFY, EF127044.1-LFY.m1 (mRNA) Crataegus nigra

Transcript Overview
NameLFY
Unique NameEF127044.1-LFY.m1
TypemRNA
OrganismCrataegus nigra ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
LFYEF127044.1-LFYCrataegus nigragene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
LFYLFYCrataegus nigragene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
EF127044.1-LFY.m1-cds1EF127044.1-LFY.m1-cds1Crataegus nigraCDS
EF127044.1-LFY.m1-cds2EF127044.1-LFY.m1-cds2Crataegus nigraCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
LFYEF127044.1-LFY.p1Crataegus nigrapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI121485085
nuccoreEF127044.1
Alignments
Feature NameTypeLocationAnalysis
EF127044 region EF127044:1..345+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
ProductLEAFY protein
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>EF127044.1-LFY.m1 ID=EF127044.1-LFY.m1|Name=LFY|organism=Crataegus nigra|type=mRNA|length=210bp
atggtgacggagccgggggaggtggcgcgtggcaaaaagaacggtctcga
ttacctcttccatctctacgagcaatgccgcgatttcttgatccaggtcc
agaacattgccaaggagcgcggtgaaaaatgtcccaccaaggtgacaaac
caagtgtttaggtatgccaaaaaggcgggggcaagctacatcaacaaacc
caaaatgcgc
back to top

protein sequence of LFY

>EF127044.1-LFY.p1 ID=EF127044.1-LFY.p1|Name=LFY|organism=Crataegus nigra|type=polypeptide|length=70bp
MVTEPGEVARGKKNGLDYLFHLYEQCRDFLIQVQNIAKERGEKCPTKVTN
QVFRYAKKAGASYINKPKMR
back to top

mRNA from alignment at EF127044:1..345+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>EF127044.1-LFY.m1 ID=EF127044.1-LFY.m1|Name=LFY|organism=Crataegus nigra|type=mRNA|length=345bp|location=Sequence derived from alignment at EF127044:1..345+ (Crataegus nigra)
atggtgacggagccgggggaggtggcgcgtggcaaaaagaacggtctcga ttacctcttccatctctacgagcaatgccgcgatttcttgatccaggtcc agaacattgccaaggagcgcggtgaaaaatgtcccaccaaggtacgaagt ttcacccgtctcccctctttacgtacgctgatttctactgtggcaattaa ttaacagtaaaaattcttgtatgaagtccatcaaatttccttttgcattt gtttactctttacattatatatgcaggtgacaaaccaagtgtttaggtat gccaaaaaggcgggggcaagctacatcaacaaacccaaaatgcgc
back to top

Coding sequence (CDS) from alignment at EF127044:1..345+

>EF127044.1-LFY.m1 ID=EF127044.1-LFY.m1|Name=LFY|organism=Crataegus nigra|type=CDS|length=210bp|location=Sequence derived from alignment at EF127044:1..345+ (Crataegus nigra)
atggtgacggagccgggggaggtggcgcgtggcaaaaagaacggtctcga
ttacctcttccatctctacgagcaatgccgcgatttcttgatccaggtcc
agaacattgccaaggagcgcggtgaaaaatgtcccaccaaggtgacaaac
caagtgtttaggtatgccaaaaaggcgggggcaagctacatcaacaaacc
caaaatgcgc
back to top