CWINV, AF000521.1-CWINV.m1 (mRNA) Fragaria x ananassa

Transcript Overview
NameCWINV
Unique NameAF000521.1-CWINV.m1
TypemRNA
OrganismFragaria x ananassa (Strawberry)
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
CWINVCWINVFragaria x ananassagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
AF000521.1-CWINV.m1-cds1AF000521.1-CWINV.m1-cds1Fragaria x ananassaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
CWINVAF000521.1-CWINV.p1Fragaria x ananassapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI4205115
nuccoreAF000521.1
Alignments
Feature NameTypeLocationAnalysis
AF000521 region AF000521:1..1734+ NCBI Rosaceae gene and mRNA sequences
LG4 chromosome LG4:23090886..23094405- Fragaria vesca Whole Genome v1.0 (build 8) Assembly & Annotation
Properties
Property NameValue
Productcell wall invertase precursor
Sourcegenbank
Functionsucrose hydrolysis
Sequences
The following sequences are available for this feature:

mRNA sequence

>AF000521.1-CWINV.m1 ID=AF000521.1-CWINV.m1|Name=CWINV|organism=Fragaria x ananassa|type=mRNA|length=1734bp
atgatattctctctttggcaattctgccttctttcacttttgctttcttt
tggtgttattgagcttcaagcttcccaccatgtctatagcaaccttcaaa
ctacccaacttgcttcaacacatccccaagctaaagacccttacagaact
ggttatcatttccagcctcgcaagaattggatcaatgatccaaatgggcc
actgatttacaagggcatttaccatcttttctatcagtacaatcccagca
gtgtagtttggggtaacattgtttgggcacattccacatccactgatctc
gtcaactggattccacatgaagctgctatctacccatcaattctctccga
tatcaatggctgttggtcggggtccgtcacaatccttcccagcggaaagc
cggccattttatacaccggaatcaaccccgacaaagaacaagttcaaaac
ttggcatttccaaaaaacctttccgacccatttcttagggagtgggttaa
agtcccacaaaaccctctaatggctccaactcaagctaaccaaatcaatg
ccagctcatttagggatcctaccactgcttggctagggccagataagaga
tggaggttgatcattggaagcaaaaggaaccacaggggactagctatcct
ctacagaagcaaagatttcatgcattggactaaggctaaacatccattat
attcaacgccaaaaaatggtatgtgggaatgccctgattttttcccagtt
tcgaagactaagttgcttggtcttgacacatctgcaattggtccggatgt
taagcatgtactcaaagttagcttggacaacactaggaaagagtactaca
caattggtacatataatgtgagcaaggatatctatatcccagatgatgga
tcaattgagagtgattctggtttgagatatgattatggtaagttttatgc
ttcaaaaactttctttgacagtgctaagaaccgcagaatcttgtggggtt
ggatcaatgagtcctcaagtgttagtggtgacatcaagaaaggatggtct
ggactccaggcaattccaaggactattgtgctcgacaaatctagaaagca
attggtgcaatggcctgtagtggagcttgagaaacttagaacaaacgagg
tcaagttaccaagcactctccttaaaggaggatcacttcatgaagtcatt
ggtgtcacagcagcacaggctgatgtagatgttgcatttgagataagtga
tctcaagaaagcagaagttatggatccaagttggactaatgcacaacttt
tgtgtagtaaaaagggtacctcagtgaaaggggctctaggaccatttgga
ttgttggcatttgtttcaaaggatttgaaagaaaagacagcaatcttcta
tagaattttcaagtctcacaacaataacaacaaatatgtggttcttatgt
gcagtgaccaaagcaggtcttccctaaacccagataatgatatgacaact
tatggaacatttgtaaacgtggatcctcttcatgaaaaattgtcactaag
aagcttgattgatcactctatagtggagagttttggtggaaaaggcaagg
agtgcataacagctagggtgtatcctacattggctgttgatggtgatacc
catttatatgctttcaattatggaagtgagagtgtcaaaatcgcaggaag
tgcatggagcatgaaaactgctaaaatcaattga
back to top

protein sequence of CWINV

>AF000521.1-CWINV.p1 ID=AF000521.1-CWINV.p1|Name=CWINV|organism=Fragaria x ananassa|type=polypeptide|length=577bp
MIFSLWQFCLLSLLLSFGVIELQASHHVYSNLQTTQLASTHPQAKDPYRT
GYHFQPRKNWINDPNGPLIYKGIYHLFYQYNPSSVVWGNIVWAHSTSTDL
VNWIPHEAAIYPSILSDINGCWSGSVTILPSGKPAILYTGINPDKEQVQN
LAFPKNLSDPFLREWVKVPQNPLMAPTQANQINASSFRDPTTAWLGPDKR
WRLIIGSKRNHRGLAILYRSKDFMHWTKAKHPLYSTPKNGMWECPDFFPV
SKTKLLGLDTSAIGPDVKHVLKVSLDNTRKEYYTIGTYNVSKDIYIPDDG
SIESDSGLRYDYGKFYASKTFFDSAKNRRILWGWINESSSVSGDIKKGWS
GLQAIPRTIVLDKSRKQLVQWPVVELEKLRTNEVKLPSTLLKGGSLHEVI
GVTAAQADVDVAFEISDLKKAEVMDPSWTNAQLLCSKKGTSVKGALGPFG
LLAFVSKDLKEKTAIFYRIFKSHNNNNKYVVLMCSDQSRSSLNPDNDMTT
YGTFVNVDPLHEKLSLRSLIDHSIVESFGGKGKECITARVYPTLAVDGDT
HLYAFNYGSESVKIAGSAWSMKTAKIN
back to top

mRNA from alignment at AF000521:1..1734+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>AF000521.1-CWINV.m1 ID=AF000521.1-CWINV.m1|Name=CWINV|organism=Fragaria x ananassa|type=mRNA|length=1734bp|location=Sequence derived from alignment at AF000521:1..1734+ (Fragaria x ananassa)
atgatattctctctttggcaattctgccttctttcacttttgctttcttt tggtgttattgagcttcaagcttcccaccatgtctatagcaaccttcaaa ctacccaacttgcttcaacacatccccaagctaaagacccttacagaact ggttatcatttccagcctcgcaagaattggatcaatgatccaaatgggcc actgatttacaagggcatttaccatcttttctatcagtacaatcccagca gtgtagtttggggtaacattgtttgggcacattccacatccactgatctc gtcaactggattccacatgaagctgctatctacccatcaattctctccga tatcaatggctgttggtcggggtccgtcacaatccttcccagcggaaagc cggccattttatacaccggaatcaaccccgacaaagaacaagttcaaaac ttggcatttccaaaaaacctttccgacccatttcttagggagtgggttaa agtcccacaaaaccctctaatggctccaactcaagctaaccaaatcaatg ccagctcatttagggatcctaccactgcttggctagggccagataagaga tggaggttgatcattggaagcaaaaggaaccacaggggactagctatcct ctacagaagcaaagatttcatgcattggactaaggctaaacatccattat attcaacgccaaaaaatggtatgtgggaatgccctgattttttcccagtt tcgaagactaagttgcttggtcttgacacatctgcaattggtccggatgt taagcatgtactcaaagttagcttggacaacactaggaaagagtactaca caattggtacatataatgtgagcaaggatatctatatcccagatgatgga tcaattgagagtgattctggtttgagatatgattatggtaagttttatgc ttcaaaaactttctttgacagtgctaagaaccgcagaatcttgtggggtt ggatcaatgagtcctcaagtgttagtggtgacatcaagaaaggatggtct ggactccaggcaattccaaggactattgtgctcgacaaatctagaaagca attggtgcaatggcctgtagtggagcttgagaaacttagaacaaacgagg tcaagttaccaagcactctccttaaaggaggatcacttcatgaagtcatt ggtgtcacagcagcacaggctgatgtagatgttgcatttgagataagtga tctcaagaaagcagaagttatggatccaagttggactaatgcacaacttt tgtgtagtaaaaagggtacctcagtgaaaggggctctaggaccatttgga ttgttggcatttgtttcaaaggatttgaaagaaaagacagcaatcttcta tagaattttcaagtctcacaacaataacaacaaatatgtggttcttatgt gcagtgaccaaagcaggtcttccctaaacccagataatgatatgacaact tatggaacatttgtaaacgtggatcctcttcatgaaaaattgtcactaag aagcttgattgatcactctatagtggagagttttggtggaaaaggcaagg agtgcataacagctagggtgtatcctacattggctgttgatggtgatacc catttatatgctttcaattatggaagtgagagtgtcaaaatcgcaggaag tgcatggagcatgaaaactgctaaaatcaattga
back to top

Coding sequence (CDS) from alignment at AF000521:1..1734+

>AF000521.1-CWINV.m1 ID=AF000521.1-CWINV.m1|Name=CWINV|organism=Fragaria x ananassa|type=CDS|length=1734bp|location=Sequence derived from alignment at AF000521:1..1734+ (Fragaria x ananassa)
atgatattctctctttggcaattctgccttctttcacttttgctttcttt
tggtgttattgagcttcaagcttcccaccatgtctatagcaaccttcaaa
ctacccaacttgcttcaacacatccccaagctaaagacccttacagaact
ggttatcatttccagcctcgcaagaattggatcaatgatccaaatgggcc
actgatttacaagggcatttaccatcttttctatcagtacaatcccagca
gtgtagtttggggtaacattgtttgggcacattccacatccactgatctc
gtcaactggattccacatgaagctgctatctacccatcaattctctccga
tatcaatggctgttggtcggggtccgtcacaatccttcccagcggaaagc
cggccattttatacaccggaatcaaccccgacaaagaacaagttcaaaac
ttggcatttccaaaaaacctttccgacccatttcttagggagtgggttaa
agtcccacaaaaccctctaatggctccaactcaagctaaccaaatcaatg
ccagctcatttagggatcctaccactgcttggctagggccagataagaga
tggaggttgatcattggaagcaaaaggaaccacaggggactagctatcct
ctacagaagcaaagatttcatgcattggactaaggctaaacatccattat
attcaacgccaaaaaatggtatgtgggaatgccctgattttttcccagtt
tcgaagactaagttgcttggtcttgacacatctgcaattggtccggatgt
taagcatgtactcaaagttagcttggacaacactaggaaagagtactaca
caattggtacatataatgtgagcaaggatatctatatcccagatgatgga
tcaattgagagtgattctggtttgagatatgattatggtaagttttatgc
ttcaaaaactttctttgacagtgctaagaaccgcagaatcttgtggggtt
ggatcaatgagtcctcaagtgttagtggtgacatcaagaaaggatggtct
ggactccaggcaattccaaggactattgtgctcgacaaatctagaaagca
attggtgcaatggcctgtagtggagcttgagaaacttagaacaaacgagg
tcaagttaccaagcactctccttaaaggaggatcacttcatgaagtcatt
ggtgtcacagcagcacaggctgatgtagatgttgcatttgagataagtga
tctcaagaaagcagaagttatggatccaagttggactaatgcacaacttt
tgtgtagtaaaaagggtacctcagtgaaaggggctctaggaccatttgga
ttgttggcatttgtttcaaaggatttgaaagaaaagacagcaatcttcta
tagaattttcaagtctcacaacaataacaacaaatatgtggttcttatgt
gcagtgaccaaagcaggtcttccctaaacccagataatgatatgacaact
tatggaacatttgtaaacgtggatcctcttcatgaaaaattgtcactaag
aagcttgattgatcactctatagtggagagttttggtggaaaaggcaagg
agtgcataacagctagggtgtatcctacattggctgttgatggtgatacc
catttatatgctttcaattatggaagtgagagtgtcaaaatcgcaggaag
tgcatggagcatgaaaactgctaaaatcaattga
back to top