S1-RNase, EU427454.1-S1-RNase.m1 (mRNA) Malus x domestica

Transcript Overview
NameS1-RNase
Unique NameEU427454.1-S1-RNase.m1
TypemRNA
OrganismMalus x domestica (Apple)
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
S1-RNaseEU427454.1-S1-RNaseMalus x domesticagene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
S1-RNaseS1-RNaseMalus x domesticagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
EU427454.1-S1-RNase.m1-cds1EU427454.1-S1-RNase.m1-cds1Malus x domesticaCDS
EU427454.1-S1-RNase.m1-cds2EU427454.1-S1-RNase.m1-cds2Malus x domesticaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
S1-RNaseEU427454.1-S1-RNase.p1Malus x domesticapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI167509210
nuccoreEU427454.1
Alignments
Feature NameTypeLocationAnalysis
EU427454 region EU427454:1..538+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
ProductS1-RNase
Sourcegenbank
Genbank noteself-incompatibility ribonuclease
Sequences
The following sequences are available for this feature:

mRNA sequence

>EU427454.1-S1-RNase.m1 ID=EU427454.1-S1-RNase.m1|Name=S1-RNase|organism=Malus x domestica|type=mRNA|length=194bp
tttacgcagcaatatcagccggctgtctgcaactctaatccaactccttg
taaggatcctcctgacaagttgtttaccgttcacggtttgtggccttcaa
actcgaatggaaatgacccagaatattgtaaggcaccgccatatcatacg
ataaaaatgctcgaaccccagttggtaatgatttggccgaacgt
back to top

protein sequence of S1-RNase

>EU427454.1-S1-RNase.p1 ID=EU427454.1-S1-RNase.p1|Name=S1-RNase|organism=Malus x domestica|type=polypeptide|length=65bp
FTQQYQPAVCNSNPTPCKDPPDKLFTVHGLWPSNSNGNDPEYCKAPPYHT
IKMLEPQLVMIWPNV
back to top

mRNA from alignment at EU427454:1..538+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>EU427454.1-S1-RNase.m1 ID=EU427454.1-S1-RNase.m1|Name=S1-RNase|organism=Malus x domestica|type=mRNA|length=538bp|location=Sequence derived from alignment at EU427454:1..538+ (Malus x domestica)
tttacgcagcaatatcagccggctgtctgcaactctaatccaactccttg taaggatcctcctgacaagttgtttaccgttcacggtttgtggccttcaa actcgaatggaaatgacccagaatattgtaaggcaccgccatatcatacg gtaatattattagcataatcagatagtcaatattatttctctcatttatg tacttgtgtgtgtgtatatatatatttttggataatgctaaagtcaccaa gtttttaaaccaaattatgtgtcacagtataaaataaacacgttaatcaa cacttaaataataattcaatcatcaacatctacatcatttgattacaaaa aagtttgtcttcctagcattactctatattttttttatatatacatatac tcaacacaggttttcatgcaggcgtgtagaaatattacaattaatttaaa atttaatcataaattatttctattatatattattatattgtcagataaaa atgctcgaaccccagttggtaatgatttggccgaacgt
back to top

Coding sequence (CDS) from alignment at EU427454:1..538+

>EU427454.1-S1-RNase.m1 ID=EU427454.1-S1-RNase.m1|Name=S1-RNase|organism=Malus x domestica|type=CDS|length=194bp|location=Sequence derived from alignment at EU427454:1..538+ (Malus x domestica)
tttacgcagcaatatcagccggctgtctgcaactctaatccaactccttg
taaggatcctcctgacaagttgtttaccgttcacggtttgtggccttcaa
actcgaatggaaatgacccagaatattgtaaggcaccgccatatcatacg
ataaaaatgctcgaaccccagttggtaatgatttggccgaacgt
back to top