BRP37, AM075245.1-BRP37.m1 (mRNA) Rosa hybrid cultivar

Transcript Overview
NameBRP37
Unique NameAM075245.1-BRP37.m1
TypemRNA
OrganismRosa hybrid cultivar ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
BRP37AM075245.1-BRP37Rosa hybrid cultivargene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
BRP37BRP37Rosa hybrid cultivargene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
AM075245.1-BRP37.m1-cds1AM075245.1-BRP37.m1-cds1Rosa hybrid cultivarCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
BRP37AM075245.1-BRP37.p1Rosa hybrid cultivarpolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GIUniProtKB/TrEMBL:Q3ZUT3
nuccoreAM075245.1
Alignments
Feature NameTypeLocationAnalysis
AM075245 region AM075245:1..677+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
Productputative LZ-NBS-LRR resistance protein
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>AM075245.1-BRP37.m1 ID=AM075245.1-BRP37.m1|Name=BRP37|organism=Rosa hybrid cultivar|type=mRNA|length=677bp
cttgcccaagatgcctataacgatgaaagggttacagcccattttgataa
gaaagtatgggtttgtgtctcagacccttttgatgagatcaagattgcta
aagcgatcattgaaagtctcgtaggaaccccaaacagttcaaatgagttg
gaaattttattgcaatgtatcaagactcatatcgagaatcatatcgagaa
taggaagttacttcttgttctagatgatgtgtggaccgaagacgaaacaa
agtgggaaaatttgaaactaccaataataatgcaaagttgtgaagaagga
agttcaatactggtgaccacgcgaaaacaagaggttgctaaaattatgag
agcaaccaacaacatgatccatttagatgagttgaattataaggattgtt
tggctttgttcaatagcattgcgtttttggatagggatgaagatgaggct
gatgagttgggagatattggtaagaaaattgtgaaacggtgtaaaggttt
gcctcttgctgcaaagactttaggtagtctagtgtggtataagaaaacaa
gaaaggaatgggaggatgttctgaagagtgagatatgggaattagaaaaa
gttgagcaacatgttttccgaccactgttgcttagttattatgatttggc
tcctgcagtcaaaagatgtcttttgta
back to top

protein sequence of BRP37

>AM075245.1-BRP37.p1 ID=AM075245.1-BRP37.p1|Name=BRP37|organism=Rosa hybrid cultivar|type=polypeptide|length=225bp
LAQDAYNDERVTAHFDKKVWVCVSDPFDEIKIAKAIIESLVGTPNSSNEL
EILLQCIKTHIENHIENRKLLLVLDDVWTEDETKWENLKLPIIMQSCEEG
SSILVTTRKQEVAKIMRATNNMIHLDELNYKDCLALFNSIAFLDRDEDEA
DELGDIGKKIVKRCKGLPLAAKTLGSLVWYKKTRKEWEDVLKSEIWELEK
VEQHVFRPLLLSYYDLAPAVKRCLL
back to top

mRNA from alignment at AM075245:1..677+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>AM075245.1-BRP37.m1 ID=AM075245.1-BRP37.m1|Name=BRP37|organism=Rosa hybrid cultivar|type=mRNA|length=677bp|location=Sequence derived from alignment at AM075245:1..677+ (Rosa hybrid cultivar)
cttgcccaagatgcctataacgatgaaagggttacagcccattttgataa gaaagtatgggtttgtgtctcagacccttttgatgagatcaagattgcta aagcgatcattgaaagtctcgtaggaaccccaaacagttcaaatgagttg gaaattttattgcaatgtatcaagactcatatcgagaatcatatcgagaa taggaagttacttcttgttctagatgatgtgtggaccgaagacgaaacaa agtgggaaaatttgaaactaccaataataatgcaaagttgtgaagaagga agttcaatactggtgaccacgcgaaaacaagaggttgctaaaattatgag agcaaccaacaacatgatccatttagatgagttgaattataaggattgtt tggctttgttcaatagcattgcgtttttggatagggatgaagatgaggct gatgagttgggagatattggtaagaaaattgtgaaacggtgtaaaggttt gcctcttgctgcaaagactttaggtagtctagtgtggtataagaaaacaa gaaaggaatgggaggatgttctgaagagtgagatatgggaattagaaaaa gttgagcaacatgttttccgaccactgttgcttagttattatgatttggc tcctgcagtcaaaagatgtcttttgta
back to top

Coding sequence (CDS) from alignment at AM075245:1..677+

>AM075245.1-BRP37.m1 ID=AM075245.1-BRP37.m1|Name=BRP37|organism=Rosa hybrid cultivar|type=CDS|length=677bp|location=Sequence derived from alignment at AM075245:1..677+ (Rosa hybrid cultivar)
cttgcccaagatgcctataacgatgaaagggttacagcccattttgataa
gaaagtatgggtttgtgtctcagacccttttgatgagatcaagattgcta
aagcgatcattgaaagtctcgtaggaaccccaaacagttcaaatgagttg
gaaattttattgcaatgtatcaagactcatatcgagaatcatatcgagaa
taggaagttacttcttgttctagatgatgtgtggaccgaagacgaaacaa
agtgggaaaatttgaaactaccaataataatgcaaagttgtgaagaagga
agttcaatactggtgaccacgcgaaaacaagaggttgctaaaattatgag
agcaaccaacaacatgatccatttagatgagttgaattataaggattgtt
tggctttgttcaatagcattgcgtttttggatagggatgaagatgaggct
gatgagttgggagatattggtaagaaaattgtgaaacggtgtaaaggttt
gcctcttgctgcaaagactttaggtagtctagtgtggtataagaaaacaa
gaaaggaatgggaggatgttctgaagagtgagatatgggaattagaaaaa
gttgagcaacatgttttccgaccactgttgcttagttattatgatttggc
tcctgcagtcaaaagatgtcttttgta
back to top