BRP22, AM075230.1-BRP22.m1 (mRNA) Rosa hybrid cultivar

Transcript Overview
NameBRP22
Unique NameAM075230.1-BRP22.m1
TypemRNA
OrganismRosa hybrid cultivar ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
BRP22AM075230.1-BRP22Rosa hybrid cultivargene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
BRP22BRP22Rosa hybrid cultivargene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
AM075230.1-BRP22.m1-cds1AM075230.1-BRP22.m1-cds1Rosa hybrid cultivarCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
BRP22AM075230.1-BRP22.p1Rosa hybrid cultivarpolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GIUniProtKB/TrEMBL:Q3ZUU7
nuccoreAM075230.1
Alignments
Feature NameTypeLocationAnalysis
AM075230 region AM075230:1..662+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
Productputative TIR-NBS-LRR resistance protein
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>AM075230.1-BRP22.m1 ID=AM075230.1-BRP22.m1|Name=BRP22|organism=Rosa hybrid cultivar|type=mRNA|length=662bp
cttgctggtgttgtattcaaccgactctcatctcaattcgaagcttccta
tttccttgctgatgtcagggaaaaatatggcaaagatagaccacacggtt
tgcgagatgaactttttcgcaacttattgaaggatgaaagtctaaggatc
ggcactccatccgtaggatcaactttaaccaaacagaggctctcccgtac
aaaggtcctcgttgtgcttgatgatgtgaatgatgttaggcaactagaaa
ctttagttggtgatcaggttcaatttggacccggaagtagaatcattata
acaactagagatatgcatcaacttagagagatgcgacagctgcgtaaagg
agctaaccatgatgttgtaatatacaaggcagaggaactagatcgtaatg
aagcacttcagctcttccacttgaatgattctgaggaaatcagttgcgga
gcagaatataccgaattagtgagaacggtggtgcattatgctgcgggaat
tcccttagcccttaaaatatggggttccttatttcgtcgatgcaagagca
cacaagagcgggaaagtttcttgaaaaagttgaaaaggtttcctgaaaag
aaacttcaagatgtgtataggataagttatgatgcattaggagaaaatga
gagggagatatt
back to top

protein sequence of BRP22

>AM075230.1-BRP22.p1 ID=AM075230.1-BRP22.p1|Name=BRP22|organism=Rosa hybrid cultivar|type=polypeptide|length=220bp
LAGVVFNRLSSQFEASYFLADVREKYGKDRPHGLRDELFRNLLKDESLRI
GTPSVGSTLTKQRLSRTKVLVVLDDVNDVRQLETLVGDQVQFGPGSRIII
TTRDMHQLREMRQLRKGANHDVVIYKAEELDRNEALQLFHLNDSEEISCG
AEYTELVRTVVHYAAGIPLALKIWGSLFRRCKSTQERESFLKKLKRFPEK
KLQDVYRISYDALGENEREI
back to top

mRNA from alignment at AM075230:1..662+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>AM075230.1-BRP22.m1 ID=AM075230.1-BRP22.m1|Name=BRP22|organism=Rosa hybrid cultivar|type=mRNA|length=662bp|location=Sequence derived from alignment at AM075230:1..662+ (Rosa hybrid cultivar)
cttgctggtgttgtattcaaccgactctcatctcaattcgaagcttccta tttccttgctgatgtcagggaaaaatatggcaaagatagaccacacggtt tgcgagatgaactttttcgcaacttattgaaggatgaaagtctaaggatc ggcactccatccgtaggatcaactttaaccaaacagaggctctcccgtac aaaggtcctcgttgtgcttgatgatgtgaatgatgttaggcaactagaaa ctttagttggtgatcaggttcaatttggacccggaagtagaatcattata acaactagagatatgcatcaacttagagagatgcgacagctgcgtaaagg agctaaccatgatgttgtaatatacaaggcagaggaactagatcgtaatg aagcacttcagctcttccacttgaatgattctgaggaaatcagttgcgga gcagaatataccgaattagtgagaacggtggtgcattatgctgcgggaat tcccttagcccttaaaatatggggttccttatttcgtcgatgcaagagca cacaagagcgggaaagtttcttgaaaaagttgaaaaggtttcctgaaaag aaacttcaagatgtgtataggataagttatgatgcattaggagaaaatga gagggagatatt
back to top

Coding sequence (CDS) from alignment at AM075230:1..662+

>AM075230.1-BRP22.m1 ID=AM075230.1-BRP22.m1|Name=BRP22|organism=Rosa hybrid cultivar|type=CDS|length=662bp|location=Sequence derived from alignment at AM075230:1..662+ (Rosa hybrid cultivar)
cttgctggtgttgtattcaaccgactctcatctcaattcgaagcttccta
tttccttgctgatgtcagggaaaaatatggcaaagatagaccacacggtt
tgcgagatgaactttttcgcaacttattgaaggatgaaagtctaaggatc
ggcactccatccgtaggatcaactttaaccaaacagaggctctcccgtac
aaaggtcctcgttgtgcttgatgatgtgaatgatgttaggcaactagaaa
ctttagttggtgatcaggttcaatttggacccggaagtagaatcattata
acaactagagatatgcatcaacttagagagatgcgacagctgcgtaaagg
agctaaccatgatgttgtaatatacaaggcagaggaactagatcgtaatg
aagcacttcagctcttccacttgaatgattctgaggaaatcagttgcgga
gcagaatataccgaattagtgagaacggtggtgcattatgctgcgggaat
tcccttagcccttaaaatatggggttccttatttcgtcgatgcaagagca
cacaagagcgggaaagtttcttgaaaaagttgaaaaggtttcctgaaaag
aaacttcaagatgtgtataggataagttatgatgcattaggagaaaatga
gagggagatatt
back to top