ANR, AY830130.1-ANR.m1 (mRNA) Malus x domestica

Transcript Overview
NameANR
Unique NameAY830130.1-ANR.m1
TypemRNA
OrganismMalus x domestica (Apple)
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
ANRANRMalus x domesticagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
AY830130.1-ANR.m1-cds1AY830130.1-ANR.m1-cds1Malus x domesticaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
ANRAY830130.1-ANR.p1Malus x domesticapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI59938849
nuccoreAY830130.1
Alignments
Feature NameTypeLocationAnalysis
AY830130 region AY830130:41..1060+ NCBI Rosaceae gene and mRNA sequences
Chr10 chromosome Chr10:39619220..39622385- Malus x domestica GDDH13 v1.1 Whole Genome Assembly & Annotation
unanchored chromosome unanchored:2247782..2250563+ Malus x domestica Whole Genome v1.0 Assembly & Annotation
unanchored chromosome unanchored:2240427..2243592- Malus x domestica Whole Genome v1.0 Assembly & Annotation
Properties
Property NameValue
Productputative anthocyanidin reductase
Sourcegenbank
Genbank noteMdANR
Sequences
The following sequences are available for this feature:

mRNA sequence

>AY830130.1-ANR.m1 ID=AY830130.1-ANR.m1|Name=ANR|organism=Malus x domestica|type=mRNA|length=1020bp
atggccacccaacaacccatctcaaagaagacggcttgcgtcgtcggcgg
aaccgggttcgtggcgtctctgctggtcaagctactgctccagaagggct
acgccgtcagaaccaccgtcagagaccctgacaaccacaagaaggtctcc
cacctcacagcactacaagagttgggtgagctagagattttcgcaggaga
tctaactgatgaagggagcttcgatgccccaatagcaggctgtgatcttg
ttttccatgttgcaacccctgtcaactttgcctcacaggacccggagaat
gatatgatcaaaccagcaatccaaggggtactaaatgttctgaagtcgtg
cgtgaaagccaaaacagttaagcgcgttgttttgacatcatcagctgcta
cagtttcgatcaatacacttgaaggaacaggtttggtcgtggatgaaaag
gattggagtgatttggagttcttgactaatgtaaagccacccacttgggg
gtaccctgcctccaagacactagctgagaagacagcttggaaatttgccg
aagaaaacaacattgatctaatcactgtgatcccttctcttatggccggt
ccttctctcaccccagacgttcccagcagtatcggccttgccatggcttt
aatcacaggagatgatttcctcataaatatggccctgaaaggtatgcaaa
tgctatcaggttcgatatccattgcacatgtggaggacgtctgccgggct
catatatttttggctgagaaagaatctgcatctggtcggtacatttgctg
tgctgccaacaccggcgttcctgagcttgctaagttcctcaacaaaagat
acccccagtacaaagtccccactgagtttggagattttccgtctgaggcc
aaactgatcatctcttcagagaagcttatcaaggaggggttcgattttaa
gtatggcatcgaagaaatatatgaccaaactgtggagtacttcaaggcaa
aggggctgctgcagaactag
back to top

protein sequence of ANR

>AY830130.1-ANR.p1 ID=AY830130.1-ANR.p1|Name=ANR|organism=Malus x domestica|type=polypeptide|length=339bp
MATQQPISKKTACVVGGTGFVASLLVKLLLQKGYAVRTTVRDPDNHKKVS
HLTALQELGELEIFAGDLTDEGSFDAPIAGCDLVFHVATPVNFASQDPEN
DMIKPAIQGVLNVLKSCVKAKTVKRVVLTSSAATVSINTLEGTGLVVDEK
DWSDLEFLTNVKPPTWGYPASKTLAEKTAWKFAEENNIDLITVIPSLMAG
PSLTPDVPSSIGLAMALITGDDFLINMALKGMQMLSGSISIAHVEDVCRA
HIFLAEKESASGRYICCAANTGVPELAKFLNKRYPQYKVPTEFGDFPSEA
KLIISSEKLIKEGFDFKYGIEEIYDQTVEYFKAKGLLQN
back to top

mRNA from alignment at AY830130:41..1060+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>AY830130.1-ANR.m1 ID=AY830130.1-ANR.m1|Name=ANR|organism=Malus x domestica|type=mRNA|length=1020bp|location=Sequence derived from alignment at AY830130:41..1060+ (Malus x domestica)
atggccacccaacaacccatctcaaagaagacggcttgcgtcgtcggcgg aaccgggttcgtggcgtctctgctggtcaagctactgctccagaagggct acgccgtcagaaccaccgtcagagaccctgacaaccacaagaaggtctcc cacctcacagcactacaagagttgggtgagctagagattttcgcaggaga tctaactgatgaagggagcttcgatgccccaatagcaggctgtgatcttg ttttccatgttgcaacccctgtcaactttgcctcacaggacccggagaat gatatgatcaaaccagcaatccaaggggtactaaatgttctgaagtcgtg cgtgaaagccaaaacagttaagcgcgttgttttgacatcatcagctgcta cagtttcgatcaatacacttgaaggaacaggtttggtcgtggatgaaaag gattggagtgatttggagttcttgactaatgtaaagccacccacttgggg gtaccctgcctccaagacactagctgagaagacagcttggaaatttgccg aagaaaacaacattgatctaatcactgtgatcccttctcttatggccggt ccttctctcaccccagacgttcccagcagtatcggccttgccatggcttt aatcacaggagatgatttcctcataaatatggccctgaaaggtatgcaaa tgctatcaggttcgatatccattgcacatgtggaggacgtctgccgggct catatatttttggctgagaaagaatctgcatctggtcggtacatttgctg tgctgccaacaccggcgttcctgagcttgctaagttcctcaacaaaagat acccccagtacaaagtccccactgagtttggagattttccgtctgaggcc aaactgatcatctcttcagagaagcttatcaaggaggggttcgattttaa gtatggcatcgaagaaatatatgaccaaactgtggagtacttcaaggcaa aggggctgctgcagaactag
back to top

Coding sequence (CDS) from alignment at AY830130:41..1060+

>AY830130.1-ANR.m1 ID=AY830130.1-ANR.m1|Name=ANR|organism=Malus x domestica|type=CDS|length=1020bp|location=Sequence derived from alignment at AY830130:41..1060+ (Malus x domestica)
atggccacccaacaacccatctcaaagaagacggcttgcgtcgtcggcgg
aaccgggttcgtggcgtctctgctggtcaagctactgctccagaagggct
acgccgtcagaaccaccgtcagagaccctgacaaccacaagaaggtctcc
cacctcacagcactacaagagttgggtgagctagagattttcgcaggaga
tctaactgatgaagggagcttcgatgccccaatagcaggctgtgatcttg
ttttccatgttgcaacccctgtcaactttgcctcacaggacccggagaat
gatatgatcaaaccagcaatccaaggggtactaaatgttctgaagtcgtg
cgtgaaagccaaaacagttaagcgcgttgttttgacatcatcagctgcta
cagtttcgatcaatacacttgaaggaacaggtttggtcgtggatgaaaag
gattggagtgatttggagttcttgactaatgtaaagccacccacttgggg
gtaccctgcctccaagacactagctgagaagacagcttggaaatttgccg
aagaaaacaacattgatctaatcactgtgatcccttctcttatggccggt
ccttctctcaccccagacgttcccagcagtatcggccttgccatggcttt
aatcacaggagatgatttcctcataaatatggccctgaaaggtatgcaaa
tgctatcaggttcgatatccattgcacatgtggaggacgtctgccgggct
catatatttttggctgagaaagaatctgcatctggtcggtacatttgctg
tgctgccaacaccggcgttcctgagcttgctaagttcctcaacaaaagat
acccccagtacaaagtccccactgagtttggagattttccgtctgaggcc
aaactgatcatctcttcagagaagcttatcaaggaggggttcgattttaa
gtatggcatcgaagaaatatatgaccaaactgtggagtacttcaaggcaa
aggggctgctgcagaactag
back to top