S34-RNase, DQ269500.1-S34-RNase.m1 (mRNA) Pyrus pyrifolia

Transcript Overview
NameS34-RNase
Unique NameDQ269500.1-S34-RNase.m1
TypemRNA
OrganismPyrus pyrifolia ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
S34-RNaseS34-RNasePyrus pyrifoliagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
DQ269500.1-S34-RNase.m1-cds1DQ269500.1-S34-RNase.m1-cds1Pyrus pyrifoliaCDS
DQ269500.1-S34-RNase.m1-cds2DQ269500.1-S34-RNase.m1-cds2Pyrus pyrifoliaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
S34-RNaseDQ269500.1-S34-RNase.p1Pyrus pyrifoliapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI78714467
nuccoreDQ269500.1
Alignments
Feature NameTypeLocationAnalysis
DQ269500 region DQ269500:29..466+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
ProductS34-RNase
Sourcegenbank
Genbank noteself-incompatibility
Sequences
The following sequences are available for this feature:

mRNA sequence

>DQ269500.1-S34-RNase.m1 ID=DQ269500.1-S34-RNase.m1|Name=S34-RNase|organism=Pyrus pyrifolia|type=mRNA|length=297bp
atggggatgacggggatgatatatatggttacgatggtattttcattaac
tgtattagtattgtgttcctctacggtgggatacgattattttcaattta
cccagcaatatcagccggctgtctgcaactctagtactactccttgtaag
gatcctgctgacaagctgtttacggttcacggtttgtggccctcaaactg
gaatggatcccacccagtaaattgcacgaataaaaccatgaattccctga
cgatgggaaatctgacagcccagttggaaattatttggccgaatgta
back to top

protein sequence of S34-RNase

>DQ269500.1-S34-RNase.p1 ID=DQ269500.1-S34-RNase.p1|Name=S34-RNase|organism=Pyrus pyrifolia|type=polypeptide|length=99bp
MGMTGMIYMVTMVFSLTVLVLCSSTVGYDYFQFTQQYQPAVCNSSTTPCK
DPADKLFTVHGLWPSNWNGSHPVNCTNKTMNSLTMGNLTAQLEIIWPNV
back to top

mRNA from alignment at DQ269500:29..466+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>DQ269500.1-S34-RNase.m1 ID=DQ269500.1-S34-RNase.m1|Name=S34-RNase|organism=Pyrus pyrifolia|type=mRNA|length=438bp|location=Sequence derived from alignment at DQ269500:29..466+ (Pyrus pyrifolia)
atggggatgacggggatgatatatatggttacgatggtattttcattaac tgtattagtattgtgttcctctacggtgggatacgattattttcaattta cccagcaatatcagccggctgtctgcaactctagtactactccttgtaag gatcctgctgacaagctgtttacggttcacggtttgtggccctcaaactg gaatggatcccacccagtaaattgcacgaataaaaccatgaattccctga cggtaatattattgattatcagatggtcaattttgtttatatacatatac tccacatagatatcatgcaccggtgtgcaaatattacaattaatttaaaa tttaatcataaatttttacctattatatatattacattgtcagatgggaa atctgacagcccagttggaaattatttggccgaatgta
back to top

Coding sequence (CDS) from alignment at DQ269500:29..466+

>DQ269500.1-S34-RNase.m1 ID=DQ269500.1-S34-RNase.m1|Name=S34-RNase|organism=Pyrus pyrifolia|type=CDS|length=297bp|location=Sequence derived from alignment at DQ269500:29..466+ (Pyrus pyrifolia)
atggggatgacggggatgatatatatggttacgatggtattttcattaac
tgtattagtattgtgttcctctacggtgggatacgattattttcaattta
cccagcaatatcagccggctgtctgcaactctagtactactccttgtaag
gatcctgctgacaagctgtttacggttcacggtttgtggccctcaaactg
gaatggatcccacccagtaaattgcacgaataaaaccatgaattccctga
cgatgggaaatctgacagcccagttggaaattatttggccgaatgta
back to top