ACO, AB031027.1-ACO.m1 (mRNA) Prunus mume

Transcript Overview
NameACO
Unique NameAB031027.1-ACO.m1
TypemRNA
OrganismPrunus mume ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
ACOACOPrunus mumegene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
AB031027.1-ACO.m1-cds1AB031027.1-ACO.m1-cds1Prunus mumeCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
ACOAB031027.1-ACO.p1Prunus mumepolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI6906698
nuccoreAB031027.1
Alignments
Feature NameTypeLocationAnalysis
AB031027 region AB031027:45..1004+ NCBI Rosaceae gene and mRNA sequences
scaffold_3 supercontig scaffold_3:16205609..16206881- Prunus persica Whole Genome v1.0 Assembly & Annotation
Properties
Property NameValue
ProductACC oxidase
Sourcegenbank
Genbank note1-aminocyclopropane-1-carboxylic acid oxidase
Sequences
The following sequences are available for this feature:

mRNA sequence

>AB031027.1-ACO.m1 ID=AB031027.1-ACO.m1|Name=ACO|organism=Prunus mume|type=mRNA|length=960bp
atggagaacttcccaatcatcaacttggagggcctcaatggagagggaag
gaaagcaacaatggaaaaaatcaaagatgcctgtgagaactggggcttct
ttgagcttgtgagtcatgggataccaactgagtttttggacacagtggag
aggttgactaaagaacactacaggcagtgcttggagcagaggttcaagga
gctggtggccagcaagggccttgaggctgtcaagacagaggtcaatgata
tggactgggaaagcaccttctacttgcgccatcttccaaaatctaacata
tctgaagttccagatcttgaggatcagtacaggaatgtgatgaaggaatt
tgcattgaagttggagaaattagcagagcagctcctagacttgctctgtg
agaatcttggacttgaaaaagggtacctcaagaaggccttctatggaaca
aatggaccaacttttggcaccaaggttagcaactaccctccttgtcccaa
ccctgagctgatcaagggtctccgggctcacaccgatgcgggcggcctca
tcctgctcttccaggatgacaaggtcagtggtctgcagctcctcaaggat
ggccaatggattgatgtgcctcccatgcgccactccattgttatcaacct
tggtgaccaacttgaggtgatcactaacgggaagtacaggagcgtggagc
acagagtgattgcccaaactgatggcaccagaatgtcaatagcttccttc
tacaaccctggcagtgatgctgtcatctaccctgcaccaacactggtgga
gaaagaagcagaggagaagaatcaagtgtaccctaaattcgtgttcgaag
actacatgaagctctatgctggcctcaagttccagcccaaagagccaaga
tttgaagccatgaaagcagtggaaaccaatatcagtttggtcccaattgc
aacagcttaa
back to top

protein sequence of ACO

>AB031027.1-ACO.p1 ID=AB031027.1-ACO.p1|Name=ACO|organism=Prunus mume|type=polypeptide|length=319bp
MENFPIINLEGLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVE
RLTKEHYRQCLEQRFKELVASKGLEAVKTEVNDMDWESTFYLRHLPKSNI
SEVPDLEDQYRNVMKEFALKLEKLAEQLLDLLCENLGLEKGYLKKAFYGT
NGPTFGTKVSNYPPCPNPELIKGLRAHTDAGGLILLFQDDKVSGLQLLKD
GQWIDVPPMRHSIVINLGDQLEVITNGKYRSVEHRVIAQTDGTRMSIASF
YNPGSDAVIYPAPTLVEKEAEEKNQVYPKFVFEDYMKLYAGLKFQPKEPR
FEAMKAVETNISLVPIATA
back to top

mRNA from alignment at AB031027:45..1004+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>AB031027.1-ACO.m1 ID=AB031027.1-ACO.m1|Name=ACO|organism=Prunus mume|type=mRNA|length=960bp|location=Sequence derived from alignment at AB031027:45..1004+ (Prunus mume)
atggagaacttcccaatcatcaacttggagggcctcaatggagagggaag gaaagcaacaatggaaaaaatcaaagatgcctgtgagaactggggcttct ttgagcttgtgagtcatgggataccaactgagtttttggacacagtggag aggttgactaaagaacactacaggcagtgcttggagcagaggttcaagga gctggtggccagcaagggccttgaggctgtcaagacagaggtcaatgata tggactgggaaagcaccttctacttgcgccatcttccaaaatctaacata tctgaagttccagatcttgaggatcagtacaggaatgtgatgaaggaatt tgcattgaagttggagaaattagcagagcagctcctagacttgctctgtg agaatcttggacttgaaaaagggtacctcaagaaggccttctatggaaca aatggaccaacttttggcaccaaggttagcaactaccctccttgtcccaa ccctgagctgatcaagggtctccgggctcacaccgatgcgggcggcctca tcctgctcttccaggatgacaaggtcagtggtctgcagctcctcaaggat ggccaatggattgatgtgcctcccatgcgccactccattgttatcaacct tggtgaccaacttgaggtgatcactaacgggaagtacaggagcgtggagc acagagtgattgcccaaactgatggcaccagaatgtcaatagcttccttc tacaaccctggcagtgatgctgtcatctaccctgcaccaacactggtgga gaaagaagcagaggagaagaatcaagtgtaccctaaattcgtgttcgaag actacatgaagctctatgctggcctcaagttccagcccaaagagccaaga tttgaagccatgaaagcagtggaaaccaatatcagtttggtcccaattgc aacagcttaa
back to top

Coding sequence (CDS) from alignment at AB031027:45..1004+

>AB031027.1-ACO.m1 ID=AB031027.1-ACO.m1|Name=ACO|organism=Prunus mume|type=CDS|length=960bp|location=Sequence derived from alignment at AB031027:45..1004+ (Prunus mume)
atggagaacttcccaatcatcaacttggagggcctcaatggagagggaag
gaaagcaacaatggaaaaaatcaaagatgcctgtgagaactggggcttct
ttgagcttgtgagtcatgggataccaactgagtttttggacacagtggag
aggttgactaaagaacactacaggcagtgcttggagcagaggttcaagga
gctggtggccagcaagggccttgaggctgtcaagacagaggtcaatgata
tggactgggaaagcaccttctacttgcgccatcttccaaaatctaacata
tctgaagttccagatcttgaggatcagtacaggaatgtgatgaaggaatt
tgcattgaagttggagaaattagcagagcagctcctagacttgctctgtg
agaatcttggacttgaaaaagggtacctcaagaaggccttctatggaaca
aatggaccaacttttggcaccaaggttagcaactaccctccttgtcccaa
ccctgagctgatcaagggtctccgggctcacaccgatgcgggcggcctca
tcctgctcttccaggatgacaaggtcagtggtctgcagctcctcaaggat
ggccaatggattgatgtgcctcccatgcgccactccattgttatcaacct
tggtgaccaacttgaggtgatcactaacgggaagtacaggagcgtggagc
acagagtgattgcccaaactgatggcaccagaatgtcaatagcttccttc
tacaaccctggcagtgatgctgtcatctaccctgcaccaacactggtgga
gaaagaagcagaggagaagaatcaagtgtaccctaaattcgtgttcgaag
actacatgaagctctatgctggcctcaagttccagcccaaagagccaaga
tttgaagccatgaaagcagtggaaaccaatatcagtttggtcccaattgc
aacagcttaa
back to top