GAPDH, KR105794.1-GAPDH.m1 (mRNA) Rosa prattii

Transcript Overview
NameGAPDH
Unique NameKR105794.1-GAPDH.m1
TypemRNA
OrganismRosa prattii ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHKR105794.1-GAPDHRosa prattiigene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHGAPDHRosa prattiigene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
KR105794.1-GAPDH.m1-cds1KR105794.1-GAPDH.m1-cds1Rosa prattiiCDS
KR105794.1-GAPDH.m1-cds2KR105794.1-GAPDH.m1-cds2Rosa prattiiCDS
KR105794.1-GAPDH.m1-cds3KR105794.1-GAPDH.m1-cds3Rosa prattiiCDS
KR105794.1-GAPDH.m1-cds4KR105794.1-GAPDH.m1-cds4Rosa prattiiCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
GAPDHKR105794.1-GAPDH.p1Rosa prattiipolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI1008903483
nuccoreKR105794.1
Alignments
Feature NameTypeLocationAnalysis
KR105794 region KR105794:1..652+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
Productglyceraldehyde 3-phosphate dehydrogenase
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>KR105794.1-GAPDH.m1 ID=KR105794.1-GAPDH.m1|Name=GAPDH|organism=Rosa prattii|type=mRNA|length=333bp
catcactgccacccagaagactgttgatggaccatcagcaaaggactgga
gaggtggacgtgctgcctcattcaacatcattcccagcagcactggagct
gccaaggctgtcggaaaggttctgcctgctctcaatggcaagttgaccgg
aatggccttccgtgtacccactgttgatgtttcagttgttgacctcactg
tcagacttgagaagaaggcaacctatgaccagatcaaggctgctatcaag
gaggagtctgagggaaagttgaagggcatcttgggttacaccgatgagga
tgttgtgtcaaccgacttcattggtgacaacag
back to top

protein sequence of GAPDH

>KR105794.1-GAPDH.p1 ID=KR105794.1-GAPDH.p1|Name=GAPDH|organism=Rosa prattii|type=polypeptide|length=110bp
ITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTG
MAFRVPTVDVSVVDLTVRLEKKATYDQIKAAIKEESEGKLKGILGYTDED
VVSTDFIGDN
back to top

mRNA from alignment at KR105794:1..652+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>KR105794.1-GAPDH.m1 ID=KR105794.1-GAPDH.m1|Name=GAPDH|organism=Rosa prattii|type=mRNA|length=652bp|location=Sequence derived from alignment at KR105794:1..652+ (Rosa prattii)
catcactggtgagttctcacttgtaaccatgtgagatatataattgttaa gatactagatttgaaaccaactaaagtcgtctgtgtatttgcaattcagc cacccagaagactgttgatggaccatcagcaaaggactggagaggtggac gtgctgcctcattcaacatcattcccagcagcactggagctgccaaggta ttttcaatattctttgtgccactgcttcagtattgttgatacacttttaa gttacatgtcagtgatacttcatctgtaacagctttattaatccttgatt ttggaatatctttaggctgtcggaaaggttctgcctgctctcaatggcaa gttgaccggaatggccttccgtgtacccactgttgatgtttcagttgttg acctcactgtcagacttgagaagaaggcaacctatgaccagatcaaggct gctatcaagtaaggcttgttgaactttgttgttaattagttgcaatcaag gtggggtgtcatgacattacaatgcatgtcttggttctaatcttttatct ttaattctgtctcaacagggaggagtctgagggaaagttgaagggcatct tgggttacaccgatgaggatgttgtgtcaaccgacttcattggtgacaac ag
back to top

Coding sequence (CDS) from alignment at KR105794:1..652+

>KR105794.1-GAPDH.m1 ID=KR105794.1-GAPDH.m1|Name=GAPDH|organism=Rosa prattii|type=CDS|length=333bp|location=Sequence derived from alignment at KR105794:1..652+ (Rosa prattii)
catcactgccacccagaagactgttgatggaccatcagcaaaggactgga
gaggtggacgtgctgcctcattcaacatcattcccagcagcactggagct
gccaaggctgtcggaaaggttctgcctgctctcaatggcaagttgaccgg
aatggccttccgtgtacccactgttgatgtttcagttgttgacctcactg
tcagacttgagaagaaggcaacctatgaccagatcaaggctgctatcaag
gaggagtctgagggaaagttgaagggcatcttgggttacaccgatgagga
tgttgtgtcaaccgacttcattggtgacaacag
back to top