LFY2, KT834249.1-LFY2.m1 (mRNA) Amelanchier arborea

Transcript Overview
NameLFY2
Unique NameKT834249.1-LFY2.m1
TypemRNA
OrganismAmelanchier arborea ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
LFY2KT834249.1-LFY2Amelanchier arboreagene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
LFY2LFY2Amelanchier arboreagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
KT834249.1-LFY2.m1-cds1KT834249.1-LFY2.m1-cds1Amelanchier arboreaCDS
KT834249.1-LFY2.m1-cds2KT834249.1-LFY2.m1-cds2Amelanchier arboreaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
LFY2KT834249.1-LFY2.p1Amelanchier arboreapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI961453867
nuccoreKT834249.1
Alignments
Feature NameTypeLocationAnalysis
KT834249 region KT834249:1..1067+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
ProductLEAFY2
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>KT834249.1-LFY2.m1 ID=KT834249.1-LFY2.m1|Name=LFY2|organism=Amelanchier arborea|type=mRNA|length=197bp
ccgtttatggtgacggagccgggggaggtggcgcgtggcaaaaagaacgg
cctcgattacctcttccatctgtacgagcaatgccgcgatttcctgatcc
aggtccagaacattgccaagcagcgcggtgaaaaatgtcccaccaaggtg
acaaaccaagtgtttaggtatgccaaaaaggcaggggcaagctacat
back to top

protein sequence of LFY2

>KT834249.1-LFY2.p1 ID=KT834249.1-LFY2.p1|Name=LFY2|organism=Amelanchier arborea|type=polypeptide|length=65bp
PFMVTEPGEVARGKKNGLDYLFHLYEQCRDFLIQVQNIAKQRGEKCPTKV
TNQVFRYAKKAGASY
back to top

mRNA from alignment at KT834249:1..1067+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>KT834249.1-LFY2.m1 ID=KT834249.1-LFY2.m1|Name=LFY2|organism=Amelanchier arborea|type=mRNA|length=1067bp|location=Sequence derived from alignment at KT834249:1..1067+ (Amelanchier arborea)
ccgtttatggtgacggagccgggggaggtggcgcgtggcaaaaagaacgg cctcgattacctcttccatctgtacgagcaatgccgcgatttcctgatcc aggtccagaacattgccaagcagcgcggtgaaaaatgtcccaccaaggta cgaagttttacccatctcccttttacgtacgctgatttctactgtagaaa ataacagtaccttcaccatgttagtcatcgatctgtgggctcattttnct gtagtacaaanntaaaggctagtagtaggcgtaataaatttcaccacaaa tctatatcttttaatcgaactcaacataaatattaaattgtcgcgtttgt agcggttttagttctagggttgtgctatccacacatcttattttacttct cacacacttcttgatgatttttgtccattgatctttttcaattcattcga tccgacggttgaaaattaaaaaagtgtnngagaagtaaaatagagtgtgt ggatattataccccttagttctatactttccgcataggcctagtttcgtt catgtattgcaagtagcatcaacattggtccatacaattcgcaaattact gtaattcaatggtaccggtcaaattttgttgaattcttgtatgaagtctg tcaaatttacccttttgtngtaccgtgcacagaacgatttggtacaaggt attaacggaagttgaggatgaagggtgtcctcgagttggaacaatttgca atctacatggactaaattagatgaaattaaacgcaggtctttgtgaaaac tacatggattaaaaacgtgtttcgggtaaatagctcagtatttagtccaa atttaattctactagtgatttgagtccgannnnnnnnnnntgattcgatt atgatgtaatcaaatacgtgttaagaaaaatgtacgcaattataatatga ccggatttaacaaaatgtataatttcgtttaatttgcatttgtttactct acacattatatatgcaggtgacaaaccaagtgtttaggtatgccaaaaag gcaggggcaagctacat
back to top

Coding sequence (CDS) from alignment at KT834249:1..1067+

>KT834249.1-LFY2.m1 ID=KT834249.1-LFY2.m1|Name=LFY2|organism=Amelanchier arborea|type=CDS|length=197bp|location=Sequence derived from alignment at KT834249:1..1067+ (Amelanchier arborea)
ccgtttatggtgacggagccgggggaggtggcgcgtggcaaaaagaacgg
cctcgattacctcttccatctgtacgagcaatgccgcgatttcctgatcc
aggtccagaacattgccaagcagcgcggtgaaaaatgtcccaccaaggtg
acaaaccaagtgtttaggtatgccaaaaaggcaggggcaagctacat
back to top