LFY1, KT834202.1-LFY1.m1 (mRNA) Amelanchier arborea

Transcript Overview
NameLFY1
Unique NameKT834202.1-LFY1.m1
TypemRNA
OrganismAmelanchier arborea ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
LFY1KT834202.1-LFY1Amelanchier arboreagene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
LFY1LFY1Amelanchier arboreagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
KT834202.1-LFY1.m1-cds1KT834202.1-LFY1.m1-cds1Amelanchier arboreaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
LFY1KT834202.1-LFY1.p1Amelanchier arboreapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI961453773
nuccoreKT834202.1
Alignments
Feature NameTypeLocationAnalysis
KT834202 region KT834202:1..141+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
ProductLEAFY1
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>KT834202.1-LFY1.m1 ID=KT834202.1-LFY1.m1|Name=LFY1|organism=Amelanchier arborea|type=mRNA|length=141bp
atggtgacggagccgggggaggtggcacgtggcaaaaagaacggtcttga
ttacctcttccatctctacgagcagtgccgtgatttcttgatccaggtcc
agaacattgccaaggagcgcggtgaaaaatgtccaaccaag
back to top

protein sequence of LFY1

>KT834202.1-LFY1.p1 ID=KT834202.1-LFY1.p1|Name=LFY1|organism=Amelanchier arborea|type=polypeptide|length=47bp
MVTEPGEVARGKKNGLDYLFHLYEQCRDFLIQVQNIAKERGEKCPTK
back to top

mRNA from alignment at KT834202:1..141+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>KT834202.1-LFY1.m1 ID=KT834202.1-LFY1.m1|Name=LFY1|organism=Amelanchier arborea|type=mRNA|length=141bp|location=Sequence derived from alignment at KT834202:1..141+ (Amelanchier arborea)
atggtgacggagccgggggaggtggcacgtggcaaaaagaacggtcttga ttacctcttccatctctacgagcagtgccgtgatttcttgatccaggtcc agaacattgccaaggagcgcggtgaaaaatgtccaaccaag
back to top

Coding sequence (CDS) from alignment at KT834202:1..141+

>KT834202.1-LFY1.m1 ID=KT834202.1-LFY1.m1|Name=LFY1|organism=Amelanchier arborea|type=CDS|length=141bp|location=Sequence derived from alignment at KT834202:1..141+ (Amelanchier arborea)
atggtgacggagccgggggaggtggcacgtggcaaaaagaacggtcttga
ttacctcttccatctctacgagcagtgccgtgatttcttgatccaggtcc
agaacattgccaaggagcgcggtgaaaaatgtccaaccaag
back to top