CBF1, KJ818900.1-CBF1.m1 (mRNA) Prunus dulcis

Transcript Overview
NameCBF1
Unique NameKJ818900.1-CBF1.m1
TypemRNA
OrganismPrunus dulcis (Almond)
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
CBF1CBF1Prunus dulcisgene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
KJ818900.1-CBF1.m1-cds1KJ818900.1-CBF1.m1-cds1Prunus dulcisCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
CBF1KJ818900.1-CBF1.p1Prunus dulcispolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI705613028
nuccoreKJ818900.1
Alignments
Feature NameTypeLocationAnalysis
KJ818900 region KJ818900:1..729+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
ProductC-repeat binding factor 1
Sourcegenbank
Genbank noteAcCBF1
Sequences
The following sequences are available for this feature:

mRNA sequence

>KJ818900.1-CBF1.m1 ID=KJ818900.1-CBF1.m1|Name=CBF1|organism=Prunus dulcis|type=mRNA|length=729bp
atgaacaggttcttctctcatttttctgactccgtcgaccagcccgagtc
aagttcgttgtccgacgccacagtcacgactctaagggcttcttggtccg
acgaggacgtcattttggcgtcgagccgaccaaagaagcgagctgggagg
agggttttcaaggagaccaggcaccctgtttataggggcgtgaggaggag
gaacaatgacaagtgggtgtgtgaaatgagagagcccaagaagacgaagt
ccaggatatggctcgggacttatccgacggcggagatggctgctcgtgcc
catgacgtggcggcattggcgtttagagggaagcttgcctgcctcaactt
ccctgactccgcttggaggctgcccttgccggcttccatggatgcaatgg
atattcggagagcggccgccgaggcagctgaggggtttaggccggtggag
tttggtggagtgtccagcagcagcagtgatgagaaggagagaatggtggt
gcaggtggaagagaagaagaagaagaagaagaaggatagtgtgaatatgg
aaaaaagtacaagcttgagcttgtcctattgggatgaggaagaagtgttt
gacatgccaaggttgcttgatgacatggctcaaggccttcttctttctcc
acctcaatgcttaggtggcgacatttgggatgacatgggaaccgatgctg
atgtcaaattgtggagtttctccaattaa
back to top

protein sequence of CBF1

>KJ818900.1-CBF1.p1 ID=KJ818900.1-CBF1.p1|Name=CBF1|organism=Prunus dulcis|type=polypeptide|length=242bp
MNRFFSHFSDSVDQPESSSLSDATVTTLRASWSDEDVILASSRPKKRAGR
RVFKETRHPVYRGVRRRNNDKWVCEMREPKKTKSRIWLGTYPTAEMAARA
HDVAALAFRGKLACLNFPDSAWRLPLPASMDAMDIRRAAAEAAEGFRPVE
FGGVSSSSSDEKERMVVQVEEKKKKKKKDSVNMEKSTSLSLSYWDEEEVF
DMPRLLDDMAQGLLLSPPQCLGGDIWDDMGTDADVKLWSFSN
back to top

mRNA from alignment at KJ818900:1..729+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>KJ818900.1-CBF1.m1 ID=KJ818900.1-CBF1.m1|Name=CBF1|organism=Prunus dulcis|type=mRNA|length=729bp|location=Sequence derived from alignment at KJ818900:1..729+ (Prunus dulcis)
atgaacaggttcttctctcatttttctgactccgtcgaccagcccgagtc aagttcgttgtccgacgccacagtcacgactctaagggcttcttggtccg acgaggacgtcattttggcgtcgagccgaccaaagaagcgagctgggagg agggttttcaaggagaccaggcaccctgtttataggggcgtgaggaggag gaacaatgacaagtgggtgtgtgaaatgagagagcccaagaagacgaagt ccaggatatggctcgggacttatccgacggcggagatggctgctcgtgcc catgacgtggcggcattggcgtttagagggaagcttgcctgcctcaactt ccctgactccgcttggaggctgcccttgccggcttccatggatgcaatgg atattcggagagcggccgccgaggcagctgaggggtttaggccggtggag tttggtggagtgtccagcagcagcagtgatgagaaggagagaatggtggt gcaggtggaagagaagaagaagaagaagaagaaggatagtgtgaatatgg aaaaaagtacaagcttgagcttgtcctattgggatgaggaagaagtgttt gacatgccaaggttgcttgatgacatggctcaaggccttcttctttctcc acctcaatgcttaggtggcgacatttgggatgacatgggaaccgatgctg atgtcaaattgtggagtttctccaattaa
back to top

Coding sequence (CDS) from alignment at KJ818900:1..729+

>KJ818900.1-CBF1.m1 ID=KJ818900.1-CBF1.m1|Name=CBF1|organism=Prunus dulcis|type=CDS|length=729bp|location=Sequence derived from alignment at KJ818900:1..729+ (Prunus dulcis)
atgaacaggttcttctctcatttttctgactccgtcgaccagcccgagtc
aagttcgttgtccgacgccacagtcacgactctaagggcttcttggtccg
acgaggacgtcattttggcgtcgagccgaccaaagaagcgagctgggagg
agggttttcaaggagaccaggcaccctgtttataggggcgtgaggaggag
gaacaatgacaagtgggtgtgtgaaatgagagagcccaagaagacgaagt
ccaggatatggctcgggacttatccgacggcggagatggctgctcgtgcc
catgacgtggcggcattggcgtttagagggaagcttgcctgcctcaactt
ccctgactccgcttggaggctgcccttgccggcttccatggatgcaatgg
atattcggagagcggccgccgaggcagctgaggggtttaggccggtggag
tttggtggagtgtccagcagcagcagtgatgagaaggagagaatggtggt
gcaggtggaagagaagaagaagaagaagaagaaggatagtgtgaatatgg
aaaaaagtacaagcttgagcttgtcctattgggatgaggaagaagtgttt
gacatgccaaggttgcttgatgacatggctcaaggccttcttctttctcc
acctcaatgcttaggtggcgacatttgggatgacatgggaaccgatgctg
atgtcaaattgtggagtttctccaattaa
back to top