GAPDH, KM353429.1-GAPDH.m1 (mRNA) Rosa setigera

Transcript Overview
NameGAPDH
Unique NameKM353429.1-GAPDH.m1
TypemRNA
OrganismRosa setigera ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHKM353429.1-GAPDHRosa setigeragene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHGAPDHRosa setigeragene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
KM353429.1-GAPDH.m1-cds1KM353429.1-GAPDH.m1-cds1Rosa setigeraCDS
KM353429.1-GAPDH.m1-cds2KM353429.1-GAPDH.m1-cds2Rosa setigeraCDS
KM353429.1-GAPDH.m1-cds3KM353429.1-GAPDH.m1-cds3Rosa setigeraCDS
KM353429.1-GAPDH.m1-cds4KM353429.1-GAPDH.m1-cds4Rosa setigeraCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
GAPDHKM353429.1-GAPDH.p1Rosa setigerapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI830003054
nuccoreKM353429.1
Alignments
Feature NameTypeLocationAnalysis
KM353429 region KM353429:1..648+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
Productglyceraldehyde 3-phosphate dehydrogenase
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>KM353429.1-GAPDH.m1 ID=KM353429.1-GAPDH.m1|Name=GAPDH|organism=Rosa setigera|type=mRNA|length=330bp
catcactgccacccagaagactgttgatggaccatcagcaaaggactgga
gaggtggacgtgctgcctcattcaacatcattcccagcagcactggagct
gccaaggctgtcggaaaggttctgcctgctctcaatggcaagttgaccgg
aatggccttccgtgtacccactgttgatgtttcagttgttgacctcactg
tcagacttgagaagaaggcaacctatgaccagatcaaggctgctatcaag
gaggagtctgagggaaagttgaagggcatcttgggttacaccgatgagga
tgttgtgtcaactgacttcattggtgacaa
back to top

protein sequence of GAPDH

>KM353429.1-GAPDH.p1 ID=KM353429.1-GAPDH.p1|Name=GAPDH|organism=Rosa setigera|type=polypeptide|length=109bp
ITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTG
MAFRVPTVDVSVVDLTVRLEKKATYDQIKAAIKEESEGKLKGILGYTDED
VVSTDFIGD
back to top

mRNA from alignment at KM353429:1..648+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>KM353429.1-GAPDH.m1 ID=KM353429.1-GAPDH.m1|Name=GAPDH|organism=Rosa setigera|type=mRNA|length=648bp|location=Sequence derived from alignment at KM353429:1..648+ (Rosa setigera)
catcactggtgatttttcacttgtaaccatgtgagatatatgaatgttaa gatactagatttgaaaccaactaaagttgtctgtgtatttgcaattcagc cacccagaagactgttgatggaccatcagcaaaggactggagaggtggac gtgctgcctcattcaacatcattcccagcagcactggagctgccaaggta ttttcaatattctttgtgccactgcttcagtattgttgatacacttttaa gttgcatgtcagtggtacttcatctgtaacagctttattaatccttgatt ttggaatatctttaggctgtcggaaaggttctgcctgctctcaatggcaa gttgaccggaatggccttccgtgtacccactgttgatgtttcagttgttg acctcactgtcagacttgagaagaaggcaacctatgaccagatcaaggct gctatcaagtaaggcttgttgaactttgttgttaattagttgcaatcaag gtggggtgtcatcacattacaatgcattcttggttctaatcttttatctt taattctgtctgaacagggaggagtctgagggaaagttgaagggcatctt gggttacaccgatgaggatgttgtgtcaactgacttcattggtgacaa
back to top

Coding sequence (CDS) from alignment at KM353429:1..648+

>KM353429.1-GAPDH.m1 ID=KM353429.1-GAPDH.m1|Name=GAPDH|organism=Rosa setigera|type=CDS|length=330bp|location=Sequence derived from alignment at KM353429:1..648+ (Rosa setigera)
catcactgccacccagaagactgttgatggaccatcagcaaaggactgga
gaggtggacgtgctgcctcattcaacatcattcccagcagcactggagct
gccaaggctgtcggaaaggttctgcctgctctcaatggcaagttgaccgg
aatggccttccgtgtacccactgttgatgtttcagttgttgacctcactg
tcagacttgagaagaaggcaacctatgaccagatcaaggctgctatcaag
gaggagtctgagggaaagttgaagggcatcttgggttacaccgatgagga
tgttgtgtcaactgacttcattggtgacaa
back to top