GAPDH, KM353314.1-GAPDH.m1 (mRNA) Rosa helenae

Transcript Overview
NameGAPDH
Unique NameKM353314.1-GAPDH.m1
TypemRNA
OrganismRosa helenae ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHKM353314.1-GAPDHRosa helenaegene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHGAPDHRosa helenaegene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
KM353314.1-GAPDH.m1-cds1KM353314.1-GAPDH.m1-cds1Rosa helenaeCDS
KM353314.1-GAPDH.m1-cds2KM353314.1-GAPDH.m1-cds2Rosa helenaeCDS
KM353314.1-GAPDH.m1-cds3KM353314.1-GAPDH.m1-cds3Rosa helenaeCDS
KM353314.1-GAPDH.m1-cds4KM353314.1-GAPDH.m1-cds4Rosa helenaeCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
GAPDHKM353314.1-GAPDH.p1Rosa helenaepolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI830002824
nuccoreKM353314.1
Alignments
Feature NameTypeLocationAnalysis
KM353314 region KM353314:1..652+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
Productglyceraldehyde 3-phosphate dehydrogenase
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>KM353314.1-GAPDH.m1 ID=KM353314.1-GAPDH.m1|Name=GAPDH|organism=Rosa helenae|type=mRNA|length=333bp
catcactgccacccagaagactgttgatggaccatcagcaaaggactgga
gaggtggacgtgctgcctcattcaacatcattcccagcagcactggagct
gccaaggctgtcgggaaggttctgcctgctctcaatggcaagttgaccgg
aatggccttccgtgtacccactgttgatgtttcagttgttgacctcactg
tcagacttgagaagaaggcaacctatgaccagatcaaggctgctatcaag
gaggagtctgagggaaagttgaagggcatcttgggttacaccgatgagga
tgttgtgtcaaccgacttcattggtgacaacag
back to top

protein sequence of GAPDH

>KM353314.1-GAPDH.p1 ID=KM353314.1-GAPDH.p1|Name=GAPDH|organism=Rosa helenae|type=polypeptide|length=110bp
ITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTG
MAFRVPTVDVSVVDLTVRLEKKATYDQIKAAIKEESEGKLKGILGYTDED
VVSTDFIGDN
back to top

mRNA from alignment at KM353314:1..652+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>KM353314.1-GAPDH.m1 ID=KM353314.1-GAPDH.m1|Name=GAPDH|organism=Rosa helenae|type=mRNA|length=652bp|location=Sequence derived from alignment at KM353314:1..652+ (Rosa helenae)
catcactggtgagttttcacttgtaaccatgtgatatatatgaatgttaa gatactagatttgaaaccaactaaagtcgtctgtgtatttgcaattcagc cacccagaagactgttgatggaccatcagcaaaggactggagaggtggac gtgctgcctcattcaacatcattcccagcagcactggagctgccaaggta ttttcaatattctttgtgccactgcttcagtattgttgatacacttgtaa gttacatgtcagtgatacttcatctgtaacagctttattaatccttgatt ttggaatatctttaggctgtcgggaaggttctgcctgctctcaatggcaa gttgaccggaatggccttccgtgtacccactgttgatgtttcagttgttg acctcactgtcagacttgagaagaaggcaacctatgaccagatcaaggct gctatcaagtaaggcttgttgaactttgttgttaattagttgcaatcaag gtggggtgtcatcacattacaatgcatgtcttggttctaatcttttatct ttaaatctgtctgaacagggaggagtctgagggaaagttgaagggcatct tgggttacaccgatgaggatgttgtgtcaaccgacttcattggtgacaac ag
back to top

Coding sequence (CDS) from alignment at KM353314:1..652+

>KM353314.1-GAPDH.m1 ID=KM353314.1-GAPDH.m1|Name=GAPDH|organism=Rosa helenae|type=CDS|length=333bp|location=Sequence derived from alignment at KM353314:1..652+ (Rosa helenae)
catcactgccacccagaagactgttgatggaccatcagcaaaggactgga
gaggtggacgtgctgcctcattcaacatcattcccagcagcactggagct
gccaaggctgtcgggaaggttctgcctgctctcaatggcaagttgaccgg
aatggccttccgtgtacccactgttgatgtttcagttgttgacctcactg
tcagacttgagaagaaggcaacctatgaccagatcaaggctgctatcaag
gaggagtctgagggaaagttgaagggcatcttgggttacaccgatgagga
tgttgtgtcaaccgacttcattggtgacaacag
back to top