GAPDH, KM353301.1-GAPDH.m1 (mRNA) Rosa odorata var. gigantea

Transcript Overview
NameGAPDH
Unique NameKM353301.1-GAPDH.m1
TypemRNA
OrganismRosa odorata var. gigantea ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHKM353301.1-GAPDHRosa odorata var. giganteagene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHGAPDHRosa odorata var. giganteagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
KM353301.1-GAPDH.m1-cds1KM353301.1-GAPDH.m1-cds1Rosa odorata var. giganteaCDS
KM353301.1-GAPDH.m1-cds2KM353301.1-GAPDH.m1-cds2Rosa odorata var. giganteaCDS
KM353301.1-GAPDH.m1-cds3KM353301.1-GAPDH.m1-cds3Rosa odorata var. giganteaCDS
KM353301.1-GAPDH.m1-cds4KM353301.1-GAPDH.m1-cds4Rosa odorata var. giganteaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
GAPDHKM353301.1-GAPDH.p1Rosa odorata var. giganteapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI830002798
nuccoreKM353301.1
Alignments
Feature NameTypeLocationAnalysis
KM353301 region KM353301:1..652+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
Productglyceraldehyde 3-phosphate dehydrogenase
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>KM353301.1-GAPDH.m1 ID=KM353301.1-GAPDH.m1|Name=GAPDH|organism=Rosa odorata var. gigantea|type=mRNA|length=333bp
catcactgccacccagaagactgttgatggaccatcagcaaaggactgga
gaggtggacgtgctgcctcattcaacatcattcccagcagcactggagct
gccaaggctgtcggcaaggtactgcctgctctcaatggcaagttgaccgg
aatggccttccgcgtacccactgttgatgtttcagttgttgacctcactg
tcagacttgagaagaaggcaacctatgaccagatcaaggctgctatcaag
gaggagtctgagggaaagttgaagggcatcttgggttacaccgatgagga
tgttgtgtcaacagacttcattggtgacaacag
back to top

protein sequence of GAPDH

>KM353301.1-GAPDH.p1 ID=KM353301.1-GAPDH.p1|Name=GAPDH|organism=Rosa odorata var. gigantea|type=polypeptide|length=110bp
ITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTG
MAFRVPTVDVSVVDLTVRLEKKATYDQIKAAIKEESEGKLKGILGYTDED
VVSTDFIGDN
back to top

mRNA from alignment at KM353301:1..652+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>KM353301.1-GAPDH.m1 ID=KM353301.1-GAPDH.m1|Name=GAPDH|organism=Rosa odorata var. gigantea|type=mRNA|length=652bp|location=Sequence derived from alignment at KM353301:1..652+ (Rosa odorata var. gigantea)
catcactggtgagttttcacttgtaaccatgtgagatatatgaatgttaa gatactagatttgaaaccaactaaagtcgtctgtgtatttgcaattcagc cacccagaagactgttgatggaccatcagcaaaggactggagaggtggac gtgctgcctcattcaacatcattcccagcagcactggagctgccaaggta ttttcaatattctttgtgccactgcttcagtattgttgatacacttttaa gttgcatgtcagtgatacttcatctgtaacagctttattaatccttgatt ttggaatatctttaggctgtcggcaaggtactgcctgctctcaatggcaa gttgaccggaatggccttccgcgtacccactgttgatgtttcagttgttg acctcactgtcagacttgagaagaaggcaacctatgaccagatcaaggct gctatcaagtaaggcttgttgaactttgttgttaattagttgcaatcaag gtggggtgtcatcacattacaatgcgtgtcttggttctaatcttttatct ttaattctgtctgaatagggaggagtctgagggaaagttgaagggcatct tgggttacaccgatgaggatgttgtgtcaacagacttcattggtgacaac ag
back to top

Coding sequence (CDS) from alignment at KM353301:1..652+

>KM353301.1-GAPDH.m1 ID=KM353301.1-GAPDH.m1|Name=GAPDH|organism=Rosa odorata var. gigantea|type=CDS|length=333bp|location=Sequence derived from alignment at KM353301:1..652+ (Rosa odorata var. gigantea)
catcactgccacccagaagactgttgatggaccatcagcaaaggactgga
gaggtggacgtgctgcctcattcaacatcattcccagcagcactggagct
gccaaggctgtcggcaaggtactgcctgctctcaatggcaagttgaccgg
aatggccttccgcgtacccactgttgatgtttcagttgttgacctcactg
tcagacttgagaagaaggcaacctatgaccagatcaaggctgctatcaag
gaggagtctgagggaaagttgaagggcatcttgggttacaccgatgagga
tgttgtgtcaacagacttcattggtgacaacag
back to top