GAPDH, KJ575369.1-GAPDH.m1 (mRNA) Rosa gallica

Transcript Overview
NameGAPDH
Unique NameKJ575369.1-GAPDH.m1
TypemRNA
OrganismRosa gallica ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHKJ575369.1-GAPDHRosa gallicagene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHGAPDHRosa gallicagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
KJ575369.1-GAPDH.m1-cds1KJ575369.1-GAPDH.m1-cds1Rosa gallicaCDS
KJ575369.1-GAPDH.m1-cds2KJ575369.1-GAPDH.m1-cds2Rosa gallicaCDS
KJ575369.1-GAPDH.m1-cds3KJ575369.1-GAPDH.m1-cds3Rosa gallicaCDS
KJ575369.1-GAPDH.m1-cds4KJ575369.1-GAPDH.m1-cds4Rosa gallicaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
GAPDHKJ575369.1-GAPDH.p1Rosa gallicapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI752822497
nuccoreKJ575369.1
Alignments
Feature NameTypeLocationAnalysis
KJ575369 region KJ575369:1..673+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
Productglyceraldehyde 3-phosphate dehydrogenase
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>KJ575369.1-GAPDH.m1 ID=KJ575369.1-GAPDH.m1|Name=GAPDH|organism=Rosa gallica|type=mRNA|length=355bp
gtcttatgactaccgtgcactccatcactgccacccagaagaccgttgat
ggaccatcagcaaaggactggagaggtggacgtgctgcgtcattcaacat
cattcccagcagcactggagctgccaaggctgtcggaaaggttctgcctg
ctctcaatggcaagttgactggaatggccttccgtgtacccactgttgat
gtttcagttgttgacctcactgtcagacttgagaagaaggcaacctatga
ccagatcaaggctgctatcaaggaggagtctgagggaaagttgaagggca
tcttgggttacaccgatgaggatgttgtgtcaaccgacttcattggtgac
aatag
back to top

protein sequence of GAPDH

>KJ575369.1-GAPDH.p1 ID=KJ575369.1-GAPDH.p1|Name=GAPDH|organism=Rosa gallica|type=polypeptide|length=117bp
LMTTVHSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPA
LNGKLTGMAFRVPTVDVSVVDLTVRLEKKATYDQIKAAIKEESEGKLKGI
LGYTDEDVVSTDFIGDN
back to top

mRNA from alignment at KJ575369:1..673+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>KJ575369.1-GAPDH.m1 ID=KJ575369.1-GAPDH.m1|Name=GAPDH|organism=Rosa gallica|type=mRNA|length=673bp|location=Sequence derived from alignment at KJ575369:1..673+ (Rosa gallica)
gtcttatgactaccgtgcactccatcactggtgagttttcacttgtaacc atgtgagatatatgaatgttaaatactaggtttgaaaccaactaaagtcg tctgtgtatttgcaattcagccacccagaagaccgttgatggaccatcag caaaggactggagaggtggacgtgctgcgtcattcaacatcattcccagc agcactggagctgccaaggtattttcaatattctttgtgccactgcttca gtattgttgatacacttttaagttacatgtcagtgatacttcatctgtaa cagctttattaatccttgattttggaatatctttaggctgtcggaaaggt tctgcctgctctcaatggcaagttgactggaatggccttccgtgtaccca ctgttgatgtttcagttgttgacctcactgtcagacttgagaagaaggca acctatgaccagatcaaggctgctatcaagtaaggcttgttgaactttgt tgttaattagttgcaatcaaggtggggtgtcatcacattacaatgcatgt cttggttctaatcttttatctttaattctgtctgaacagggaggagtctg agggaaagttgaagggcatcttgggttacaccgatgaggatgttgtgtca accgacttcattggtgacaatag
back to top

Coding sequence (CDS) from alignment at KJ575369:1..673+

>KJ575369.1-GAPDH.m1 ID=KJ575369.1-GAPDH.m1|Name=GAPDH|organism=Rosa gallica|type=CDS|length=355bp|location=Sequence derived from alignment at KJ575369:1..673+ (Rosa gallica)
gtcttatgactaccgtgcactccatcactgccacccagaagaccgttgat
ggaccatcagcaaaggactggagaggtggacgtgctgcgtcattcaacat
cattcccagcagcactggagctgccaaggctgtcggaaaggttctgcctg
ctctcaatggcaagttgactggaatggccttccgtgtacccactgttgat
gtttcagttgttgacctcactgtcagacttgagaagaaggcaacctatga
ccagatcaaggctgctatcaaggaggagtctgagggaaagttgaagggca
tcttgggttacaccgatgaggatgttgtgtcaaccgacttcattggtgac
aatag
back to top