F3H, KP347503.1-F3H.m1 (mRNA) Prunus avium

Transcript Overview
NameF3H
Unique NameKP347503.1-F3H.m1
TypemRNA
OrganismPrunus avium ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
F3HF3HPrunus aviumgene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
KP347503.1-F3H.m1-cds1KP347503.1-F3H.m1-cds1Prunus aviumCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
F3HKP347503.1-F3H.p1Prunus aviumpolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI758343628
nuccoreKP347503.1
Alignments
Feature NameTypeLocationAnalysis
KP347503 region KP347503:71..1153+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
Productflavanone-3-hydroxylase
Sourcegenbank
Genbank noteflavonoid pathway enzyme
Sequences
The following sequences are available for this feature:

mRNA sequence

>KP347503.1-F3H.m1 ID=KP347503.1-F3H.m1|Name=F3H|organism=Prunus avium|type=mRNA|length=1083bp
atggctcctgctactactctcacctccattgcaggggagaaaaccctgca
acaaaaatttgtccgggacgaagatgagcgccccaaggttgcctacaaca
acttcagcaatgaaatcccgatcatttcgcttgccgggatcgacgaggaa
ggccgccgggccgagatttgcaagaagattgtggaggcttgtgaggattg
gggtatttaccagattgttgatcatggagttgatgccaagctcatctctg
aaatgaccggtctcgccagagagttcttcgctttgccgtccgaggagaag
cttcgctttgacatgtccggcggcaaaaagggtggtttcatcgtctccag
ccatttacagggagaagctgtgcaagattggcgcgaaattgtgacatact
tctcatacccaatccggcaccgggactattcgaggtggccggacaagcca
gagggatggagagaggtgacacagaagtacagcgacgagctgatggggct
ggcatgcaagcttttgggggtgttatcagaagccatgggattggatacag
aggcattgacaaaggcgtgtgtagacatggaccaaaaagttgtggtcaat
ttctacccaaaatgcccccaacccgacctcacccttggcctgaagcgcca
cactgacccaggcacaattacccttttgctccaagaccaggttggtggcc
tccaggctacaagggatggtgggaagacgtggatcaccgttcaaccagtg
gaaggagccttcgtggtcaatcttggagaccatggtcatcttctgagcaa
tgggaggttcaagaatgctgatcaccaagcagttgtgaactcaaacagca
gcaggctgtccatagccacattccagaacccagcccaagaagctatagtc
tacccactgagcatcagagagggagagaagcccattctagaggggccaat
cacctacacagagatgtacaagaagaagatgggcagggaccttgagcttg
ccaggctaaaaaagctggccaaggagcaacaatcgcaggacttgaagaag
gagaccaagtcagccgatgatatttttgcttag
back to top

protein sequence of F3H

>KP347503.1-F3H.p1 ID=KP347503.1-F3H.p1|Name=F3H|organism=Prunus avium|type=polypeptide|length=360bp
MAPATTLTSIAGEKTLQQKFVRDEDERPKVAYNNFSNEIPIISLAGIDEE
GRRAEICKKIVEACEDWGIYQIVDHGVDAKLISEMTGLAREFFALPSEEK
LRFDMSGGKKGGFIVSSHLQGEAVQDWREIVTYFSYPIRHRDYSRWPDKP
EGWREVTQKYSDELMGLACKLLGVLSEAMGLDTEALTKACVDMDQKVVVN
FYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDGGKTWITVQPV
EGAFVVNLGDHGHLLSNGRFKNADHQAVVNSNSSRLSIATFQNPAQEAIV
YPLSIREGEKPILEGPITYTEMYKKKMGRDLELARLKKLAKEQQSQDLKK
ETKSADDIFA
back to top

mRNA from alignment at KP347503:71..1153+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>KP347503.1-F3H.m1 ID=KP347503.1-F3H.m1|Name=F3H|organism=Prunus avium|type=mRNA|length=1083bp|location=Sequence derived from alignment at KP347503:71..1153+ (Prunus avium)
atggctcctgctactactctcacctccattgcaggggagaaaaccctgca acaaaaatttgtccgggacgaagatgagcgccccaaggttgcctacaaca acttcagcaatgaaatcccgatcatttcgcttgccgggatcgacgaggaa ggccgccgggccgagatttgcaagaagattgtggaggcttgtgaggattg gggtatttaccagattgttgatcatggagttgatgccaagctcatctctg aaatgaccggtctcgccagagagttcttcgctttgccgtccgaggagaag cttcgctttgacatgtccggcggcaaaaagggtggtttcatcgtctccag ccatttacagggagaagctgtgcaagattggcgcgaaattgtgacatact tctcatacccaatccggcaccgggactattcgaggtggccggacaagcca gagggatggagagaggtgacacagaagtacagcgacgagctgatggggct ggcatgcaagcttttgggggtgttatcagaagccatgggattggatacag aggcattgacaaaggcgtgtgtagacatggaccaaaaagttgtggtcaat ttctacccaaaatgcccccaacccgacctcacccttggcctgaagcgcca cactgacccaggcacaattacccttttgctccaagaccaggttggtggcc tccaggctacaagggatggtgggaagacgtggatcaccgttcaaccagtg gaaggagccttcgtggtcaatcttggagaccatggtcatcttctgagcaa tgggaggttcaagaatgctgatcaccaagcagttgtgaactcaaacagca gcaggctgtccatagccacattccagaacccagcccaagaagctatagtc tacccactgagcatcagagagggagagaagcccattctagaggggccaat cacctacacagagatgtacaagaagaagatgggcagggaccttgagcttg ccaggctaaaaaagctggccaaggagcaacaatcgcaggacttgaagaag gagaccaagtcagccgatgatatttttgcttag
back to top

Coding sequence (CDS) from alignment at KP347503:71..1153+

>KP347503.1-F3H.m1 ID=KP347503.1-F3H.m1|Name=F3H|organism=Prunus avium|type=CDS|length=1083bp|location=Sequence derived from alignment at KP347503:71..1153+ (Prunus avium)
atggctcctgctactactctcacctccattgcaggggagaaaaccctgca
acaaaaatttgtccgggacgaagatgagcgccccaaggttgcctacaaca
acttcagcaatgaaatcccgatcatttcgcttgccgggatcgacgaggaa
ggccgccgggccgagatttgcaagaagattgtggaggcttgtgaggattg
gggtatttaccagattgttgatcatggagttgatgccaagctcatctctg
aaatgaccggtctcgccagagagttcttcgctttgccgtccgaggagaag
cttcgctttgacatgtccggcggcaaaaagggtggtttcatcgtctccag
ccatttacagggagaagctgtgcaagattggcgcgaaattgtgacatact
tctcatacccaatccggcaccgggactattcgaggtggccggacaagcca
gagggatggagagaggtgacacagaagtacagcgacgagctgatggggct
ggcatgcaagcttttgggggtgttatcagaagccatgggattggatacag
aggcattgacaaaggcgtgtgtagacatggaccaaaaagttgtggtcaat
ttctacccaaaatgcccccaacccgacctcacccttggcctgaagcgcca
cactgacccaggcacaattacccttttgctccaagaccaggttggtggcc
tccaggctacaagggatggtgggaagacgtggatcaccgttcaaccagtg
gaaggagccttcgtggtcaatcttggagaccatggtcatcttctgagcaa
tgggaggttcaagaatgctgatcaccaagcagttgtgaactcaaacagca
gcaggctgtccatagccacattccagaacccagcccaagaagctatagtc
tacccactgagcatcagagagggagagaagcccattctagaggggccaat
cacctacacagagatgtacaagaagaagatgggcagggaccttgagcttg
ccaggctaaaaaagctggccaaggagcaacaatcgcaggacttgaagaag
gagaccaagtcagccgatgatatttttgcttag
back to top