|
Transcript Overview
Name | ASG4 |
Unique Name | AF403125.1-ASG4.m1 |
Type | mRNA |
Organism | Malus x domestica (Apple) |
Source | genbank |
Product | anther-specific protein ASG4 |
Genbank Note | MdASG4 |
Analyses
This mRNA is derived from or has results from the following analyses
Relationships
The following CDS feature(s) are a part of this mRNA:
Feature Name | Unique Name | Species | Type |
AF403125.1-ASG4.m1-cds1 | AF403125.1-ASG4.m1-cds1 | Malus x domestica | CDS |
The following polypeptide feature(s) derives from this mRNA:
Feature Name | Unique Name | Species | Type |
ASG4 | AF403125.1-ASG4.p1 | Malus x domestica | polypeptide |
Cross References
External references for this mRNA
Alignments
Feature Name | Type | Location | Analysis |
AF403125 |
region |
AF403125:88..354+ |
NCBI Rosaceae gene and mRNA sequences |
Chr03 |
chromosome |
Chr03:2000172..2000438- |
Malus x domestica GDDH13 v1.1 Whole Genome Assembly & Annotation |
chr3 |
chromosome |
chr3:2303284..2303550+ |
Malus x domestica Whole Genome v1.0 Assembly & Annotation |
chr3 |
chromosome |
chr3:2274795..2275062- |
Malus x domestica Whole Genome v1.0 Assembly & Annotation |
chr3 |
chromosome |
chr3:2474961..2475227- |
Malus x domestica Whole Genome v1.0p Assembly & Annotation |
Sequences
The
following sequences are available for this feature:
mRNA sequence >AF403125.1-ASG4.m1 ID=AF403125.1-ASG4.m1; Name=ASG4; organism=Malus x domestica; type=mRNA; length=267bp atggccatgaagaagattgccttggttgtcctcgtagttgccgtctgcat cagcgcagcaatggctgctgcacctgtaaagggcgctgcagccaccacct ctgcagccacccccactgcagccaccaccgctgcagccacccccgccgct gcagccacagctggccctgtagcttctactccagcacctaatggaagtag catgaacgccgttggatctctggttggagcttcactcttgtccttcttgg ccatttacttgaactaa back to topprotein sequence of ASG4 >AF403125.1-ASG4.p1 ID=AF403125.1-ASG4.p1; Name=ASG4; organism=Malus x domestica; type=polypeptide; length=88bp MAMKKIALVVLVVAVCISAAMAAAPVKGAAATTSAATPTAATTAAATPAA AATAGPVASTPAPNGSSMNAVGSLVGASLLSFLAIYLN back to topmRNA from alignment at AF403125:88..354+ Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below. >AF403125.1-ASG4.m1 ID=AF403125.1-ASG4.m1; Name=ASG4; organism=Malus x domestica; type=mRNA; length=267bp; location=Sequence derived from: AF403125:88..354+ (Malus x domestica atggccatgaagaagattgccttggttgtcctcgtagttgccgtctgcat
cagcgcagcaatggctgctgcacctgtaaagggcgctgcagccaccacct
ctgcagccacccccactgcagccaccaccgctgcagccacccccgccgct
gcagccacagctggccctgtagcttctactccagcacctaatggaagtag
catgaacgccgttggatctctggttggagcttcactcttgtccttcttgg
ccatttacttgaactaa back to topCoding sequence (CDS) from alignment at AF403125:88..354+ >AF403125.1-ASG4.m1 ID=AF403125.1-ASG4.m1; Name=ASG4; organism=Malus x domestica; type=CDS; length=267bp; location=Sequence derived from: AF403125:88..354+ (Malus x domestica atggccatgaagaagattgccttggttgtcctcgtagttgccgtctgcat cagcgcagcaatggctgctgcacctgtaaagggcgctgcagccaccacct ctgcagccacccccactgcagccaccaccgctgcagccacccccgccgct gcagccacagctggccctgtagcttctactccagcacctaatggaagtag catgaacgccgttggatctctggttggagcttcactcttgtccttcttgg ccatttacttgaactaa back to top
|