|
Transcript Overview
Name | UGT |
Unique Name | AB931688.1-UGT.m1 |
Type | mRNA |
Organism | Rubus palmatus () |
Source | genbank |
Product | UDP-glycosyltransferase homolog |
Analyses
This mRNA is derived from or has results from the following analyses
Relationships
The following CDS feature(s) are a part of this mRNA:
Feature Name | Unique Name | Species | Type |
AB931688.1-UGT.m1-cds1 | AB931688.1-UGT.m1-cds1 | Rubus palmatus | CDS |
The following polypeptide feature(s) derives from this mRNA:
Feature Name | Unique Name | Species | Type |
UGT | AB931688.1-UGT.p1 | Rubus palmatus | polypeptide |
Cross References
External references for this mRNA
Alignments
Feature Name | Type | Location | Analysis |
AB931688 |
region |
AB931688:1..349+ |
NCBI Rosaceae gene and mRNA sequences |
Sequences
The
following sequences are available for this feature:
mRNA sequence >AB931688.1-UGT.m1 ID=AB931688.1-UGT.m1; Name=UGT; organism=Rubus palmatus; type=mRNA; length=349bp ctgcttttatacacgcctattctagataaggaggtggaaggagaatactt ggatcaaaaggaaccgctcaaaatcccgggttgcaaacctgttagacccg atgatgttgctaagccgatgatgaatcggaaagatcctgaatacgagtcc ttcataagtattgcgtcggagatcggtgtgatgagtgatgggattttggt taacacctgggaagatctggagccaacaagtcttaaagccatgagagagg atccagagtggaagcagatccttaaggttccggtttatactttcggcccc atgattagaccgggagtgagctcaagtccgaggggggaggtgttgggtt back to topprotein sequence of UGT >AB931688.1-UGT.p1 ID=AB931688.1-UGT.p1; Name=UGT; organism=Rubus palmatus; type=polypeptide; length=116bp LLLYTPILDKEVEGEYLDQKEPLKIPGCKPVRPDDVAKPMMNRKDPEYES FISIASEIGVMSDGILVNTWEDLEPTSLKAMREDPEWKQILKVPVYTFGP MIRPGVSSSPRGEVLG back to topmRNA from alignment at AB931688:1..349+ Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below. >AB931688.1-UGT.m1 ID=AB931688.1-UGT.m1; Name=UGT; organism=Rubus palmatus; type=mRNA; length=349bp; location=Sequence derived from: AB931688:1..349+ (Rubus palmatus ctgcttttatacacgcctattctagataaggaggtggaaggagaatactt
ggatcaaaaggaaccgctcaaaatcccgggttgcaaacctgttagacccg
atgatgttgctaagccgatgatgaatcggaaagatcctgaatacgagtcc
ttcataagtattgcgtcggagatcggtgtgatgagtgatgggattttggt
taacacctgggaagatctggagccaacaagtcttaaagccatgagagagg
atccagagtggaagcagatccttaaggttccggtttatactttcggcccc
atgattagaccgggagtgagctcaagtccgaggggggaggtgttgggtt back to topCoding sequence (CDS) from alignment at AB931688:1..349+ >AB931688.1-UGT.m1 ID=AB931688.1-UGT.m1; Name=UGT; organism=Rubus palmatus; type=CDS; length=349bp; location=Sequence derived from: AB931688:1..349+ (Rubus palmatus ctgcttttatacacgcctattctagataaggaggtggaaggagaatactt ggatcaaaaggaaccgctcaaaatcccgggttgcaaacctgttagacccg atgatgttgctaagccgatgatgaatcggaaagatcctgaatacgagtcc ttcataagtattgcgtcggagatcggtgtgatgagtgatgggattttggt taacacctgggaagatctggagccaacaagtcttaaagccatgagagagg atccagagtggaagcagatccttaaggttccggtttatactttcggcccc atgattagaccgggagtgagctcaagtccgaggggggaggtgttgggtt back to top
|