|
Transcript Overview
Name | MT1 |
Unique Name | AF195206.1-MT1.m1 |
Type | mRNA |
Organism | Pyrus pyrifolia () |
Source | genbank |
Product | metallothionein-like protein |
Analyses
This mRNA is derived from or has results from the following analyses
Relationships
The following CDS feature(s) are a part of this mRNA:
Feature Name | Unique Name | Species | Type |
AF195206.1-MT1.m1-cds1 | AF195206.1-MT1.m1-cds1 | Pyrus pyrifolia | CDS |
The following polypeptide feature(s) derives from this mRNA:
Feature Name | Unique Name | Species | Type |
MT1 | AF195206.1-MT1.p1 | Pyrus pyrifolia | polypeptide |
Cross References
External references for this mRNA
Alignments
Feature Name | Type | Location | Analysis |
AF195206 |
region |
AF195206:97..445+ |
NCBI Rosaceae gene and mRNA sequences |
Sequences
The
following sequences are available for this feature:
mRNA sequence >AF195206.1-MT1.m1 ID=AF195206.1-MT1.m1; Name=MT1; organism=Pyrus pyrifolia; type=mRNA; length=349bp atgtcgtcgtgctgcggtggtaaatgtggttgcgggtccagctgcagctg cggcagtggctacaacgggtgtgggatggcacctgatctgagctacatgg aggggtccaccaccgagacccttttcatgggagttgctcctcagaagtcg cactttgaggcatctgagatgggagttgctgctgagaacggatgcaagtg cggggatagctgcacctgcaaccctgcaagtgcggcaagtgagtgcagat gtaccttctgcgaagaagagaatcgctgggcttctatggttagcagtagt aatctatgtgtgtgctgggtatcatgtccaatgacctcggcggacacct back to topprotein sequence of MT1 >AF195206.1-MT1.p1 ID=AF195206.1-MT1.p1; Name=MT1; organism=Pyrus pyrifolia; type=polypeptide; length=116bp MSSCCGGKCGCGSSCSCGSGYNGCGMAPDLSYMEGSTTETLFMGVAPQKS HFEASEMGVAAENGCKCGDSCTCNPASAASECRCTFCEEENRWASMVSSS NLCVCWVSCPMTSADT back to topmRNA from alignment at AF195206:97..445+ Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below. >AF195206.1-MT1.m1 ID=AF195206.1-MT1.m1; Name=MT1; organism=Pyrus pyrifolia; type=mRNA; length=349bp; location=Sequence derived from: AF195206:97..445+ (Pyrus pyrifolia atgtcgtcgtgctgcggtggtaaatgtggttgcgggtccagctgcagctg
cggcagtggctacaacgggtgtgggatggcacctgatctgagctacatgg
aggggtccaccaccgagacccttttcatgggagttgctcctcagaagtcg
cactttgaggcatctgagatgggagttgctgctgagaacggatgcaagtg
cggggatagctgcacctgcaaccctgcaagtgcggcaagtgagtgcagat
gtaccttctgcgaagaagagaatcgctgggcttctatggttagcagtagt
aatctatgtgtgtgctgggtatcatgtccaatgacctcggcggacacct back to topCoding sequence (CDS) from alignment at AF195206:97..445+ >AF195206.1-MT1.m1 ID=AF195206.1-MT1.m1; Name=MT1; organism=Pyrus pyrifolia; type=CDS; length=349bp; location=Sequence derived from: AF195206:97..445+ (Pyrus pyrifolia atgtcgtcgtgctgcggtggtaaatgtggttgcgggtccagctgcagctg cggcagtggctacaacgggtgtgggatggcacctgatctgagctacatgg aggggtccaccaccgagacccttttcatgggagttgctcctcagaagtcg cactttgaggcatctgagatgggagttgctgctgagaacggatgcaagtg cggggatagctgcacctgcaaccctgcaagtgcggcaagtgagtgcagat gtaccttctgcgaagaagagaatcgctgggcttctatggttagcagtagt aatctatgtgtgtgctgggtatcatgtccaatgacctcggcggacacct back to top
|