|
Transcript Overview
Name | SAMS |
Unique Name | AF195233.1-SAMS.m1 |
Type | mRNA |
Organism | Pyrus pyrifolia () |
Source | genbank |
Product | S-adenosylmethionine synthase |
Analyses
This mRNA is derived from or has results from the following analyses
Relationships
The following CDS feature(s) are a part of this mRNA:
Feature Name | Unique Name | Species | Type |
AF195233.1-SAMS.m1-cds1 | AF195233.1-SAMS.m1-cds1 | Pyrus pyrifolia | CDS |
The following polypeptide feature(s) derives from this mRNA:
Feature Name | Unique Name | Species | Type |
SAMS | AF195233.1-SAMS.p1 | Pyrus pyrifolia | polypeptide |
Cross References
External references for this mRNA
Alignments
Feature Name | Type | Location | Analysis |
AF195233 |
region |
AF195233:134..416+ |
NCBI Rosaceae gene and mRNA sequences |
scaffold00662 |
supercontig |
scaffold00662:23419..23700- |
Pyrus communis Genome v1.0 Draft Assembly & Annotation |
Sequences
The
following sequences are available for this feature:
mRNA sequence >AF195233.1-SAMS.m1 ID=AF195233.1-SAMS.m1; Name=SAMS; organism=Pyrus pyrifolia; type=mRNA; length=283bp atgccactgataagacccccgagctcatgccacttcacccacgtccttgc aaccaagctcggtgccaagctcactgaggttcgcaagaacgggacttgtg cttggttgaggcctgatggcaagacccaagttactattgagtatgtcaat gacaagggtgccatggtcccaattcgtgtccacactgtcctgatttcaac ccagcacgatgagaccgtgacaaacgatgaaattgccgctgatctcaagg agcatgtgatcaagcctgtgatccccgagaagt back to topprotein sequence of SAMS >AF195233.1-SAMS.p1 ID=AF195233.1-SAMS.p1; Name=SAMS; organism=Pyrus pyrifolia; type=polypeptide; length=94bp MPLIRPPSSCHFTHVLATKLGAKLTEVRKNGTCAWLRPDGKTQVTIEYVN DKGAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEK back to topmRNA from alignment at AF195233:134..416+ Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below. >AF195233.1-SAMS.m1 ID=AF195233.1-SAMS.m1; Name=SAMS; organism=Pyrus pyrifolia; type=mRNA; length=283bp; location=Sequence derived from: AF195233:134..416+ (Pyrus pyrifolia atgccactgataagacccccgagctcatgccacttcacccacgtccttgc
aaccaagctcggtgccaagctcactgaggttcgcaagaacgggacttgtg
cttggttgaggcctgatggcaagacccaagttactattgagtatgtcaat
gacaagggtgccatggtcccaattcgtgtccacactgtcctgatttcaac
ccagcacgatgagaccgtgacaaacgatgaaattgccgctgatctcaagg
agcatgtgatcaagcctgtgatccccgagaagt back to topCoding sequence (CDS) from alignment at AF195233:134..416+ >AF195233.1-SAMS.m1 ID=AF195233.1-SAMS.m1; Name=SAMS; organism=Pyrus pyrifolia; type=CDS; length=283bp; location=Sequence derived from: AF195233:134..416+ (Pyrus pyrifolia atgccactgataagacccccgagctcatgccacttcacccacgtccttgc aaccaagctcggtgccaagctcactgaggttcgcaagaacgggacttgtg cttggttgaggcctgatggcaagacccaagttactattgagtatgtcaat gacaagggtgccatggtcccaattcgtgtccacactgtcctgatttcaac ccagcacgatgagaccgtgacaaacgatgaaattgccgctgatctcaagg agcatgtgatcaagcctgtgatccccgagaagt back to top
|